Conserved Protein Domain Family
3a0901s02IAP34

?
TIGR00991: 3a0901s02IAP34 
GTP-binding protein (Chloroplast Envelope Protein Translocase)
[Transport and binding proteins, Nucleosides, purines and pyrimidines]
Statistics
?
PSSM-Id: 130064
View PSSM: TIGR00991
Aligned: 3 rows
Threshold Bit Score: 597.651
Threshold Setting Gi: 25091388
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1151244    1 MAALq-TLREWIGIQQFPPATQSKLLEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIGEKAAAVSTFQSEGLRPTLV 79
gi 6689637    1 MASP--IPREWVGLQQFPPATQTELHELLGKLKEEDVSTLTILVMGKGGVGKSSTVNSIVGERIATVSAFQSEGLRPMMW 78
gi 25091388   1 MASQqqTVREWSGINTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1151244   80 SRTRSGFTLNIIDTPGLIEGGYVNDQAINIIKRFLLNMTIDVLLYVDRLDVYRVDDLDRQVVGAITDAFGKEIWKKSALV 159
gi 6689637   79 SRTRAGFTLNIIDTPGLIEGGYINEQAVDIIKRFLLGKTIDVLLYVDRLDAYRMDTLDGQVIRAITNSFGKDIWRRSLVV 158
gi 25091388  81 SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1151244  160 LTHAQFSPPDGLNYNHFVSKRSNALLKVIQTGAQLKKQDLQGFSIPVILVENSGRCHKNESDEKILPCGTSWIPNLFNKI 239
gi 6689637  159 LTHAQLSPPDGIEYNDFFTRRSEALLRYIHSGAGIKKREYGDFPLPIALVENSGRCKTNEHGEKILPDGTPWVPKLMKEI 238
gi 25091388 161 LTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKK-DAQASDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHLVQTI 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1151244  240 TEISFNGNKAIHVDKKLVEGPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKLAWELRDSGLA---------- 309
gi 6689637  239 TVVISNGSKPIHVDQKLIDGPNPNNRWKMFIPIILAVEYFLVVKGIRRAIHADIANGKVDDWEQRYRDLVgsrdpveqkg 318
gi 25091388 240 TEVALNKSESIFVDKNLIDGPNPNQRGKLWIPLIFALQYLFLAKPIEALIRRDIATETKPAWETRDVG------------ 307

                ....*...
gi 1151244  310 ----SRRS 313
gi 6689637  319 sttrNRKA 326
gi 25091388 308 ----DRK- 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap