Conserved Protein Domain Family
3a0901s03IAP75

?
TIGR00992: 3a0901s03IAP75 
chloroplast envelope protein translocase, IAP75 family
Two families of proteins are involved in the chloroplast envelope import appartus.They are the three proteins of the outer membrane (TOC) and four proteins in the inner membrane (TIC). This family is specific for the TOC IAP75 protein. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130065
View PSSM: TIGR00992
Aligned: 3 rows
Threshold Bit Score: 979.444
Threshold Setting Gi: 16330104
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507     92 GGAGGGGGGSSSSGGGGGGWfNGD----EGSFWSRILSPARAIADEPKSEDWDSHELPADITVLLGRLSGFKKYKISDIL 167
gi 5541685   102 GGGGGGDGNFGGFGGGGGGG-DGN----DGGFWGKLFSPSPAVADEEQSPDWDSHGLPANIVVQLNKLSGFKKYKVSDIM 176
gi 499174555 117 GNLDVGVDDLPPMAPVDSAElAQAnelpHGNAVAQVAPRVAQVEQENLIAETKTDNQTDHVEPQSPLMAQAAVEEEVEAV 196
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    168 FFDRNKKSKVETQDSFLDMVSLKPGGVYTKAQ--------------------------------LQKELESLATCGMFEK 215
gi 5541685   177 FFDRRRQTTIGTEDSFFEMVSIRPGGVYTKAQ--------------------------------LQKELETLATCGMFEK 224
gi 499174555 197 EMEATEETTGVTEETPEETPSFTPDAPPTNTEgtpgptqtlpsftppaspstttpapaeeeprvLVSEVLVTGTTPELEL 276
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    216 VDMEGKTNADGSLGLTISFAESMWERADRFRCINVGLMGQSKPVEMDPDMSEKEKIEFFRRQEREYKRRISSARPCLLPT 295
gi 5541685   225 VDLEGKTKPDGTLGVTISFAESTWQSADRFRCINVGLMVQSKPIEMDSDMTDKEKLEYYRSLEKDYKRRIDRARPCLLPA 304
gi 499174555 277 LVYNAIRTQPGRTTTRTQLQEDVNAIYATGYFSNVRVAPSDTPLGVRVTFEVQANPVFTG-LNIRTVPETAEGKERILPQ 355
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    296 SVHEEIKDMLAEQGRVSARLLQKIRDRVQSWYHEEGYACAQVVNFGNLNTR-EVVCEVVEGDITKLSIQYLDKLGNVVEG 374
gi 5541685   305 PVYGEVMQMLRDQGKVSARLLQRIRDRVQKWYHDEGYACAQVVNFGNLNTK-EVVCEVVEGDITQLVIQFQDKLGNVVEG 383
gi 499174555 356 EVVDETFGEQYG-KILNLRELQEGIKTINEWYSNQGYDLAQVVGSPQVGADgQVTLVIAEGIVENIQVRFFDSEDEPVQG 434
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    375 NTEGPVVQRELPKQLLPGHTFNIEAGKQALRNINSLALFSNIEVNPRPDEMNEGSIIVEIKLKELEQKSAEVSTEWSIVP 454
gi 5541685   384 NTQVPVVRRELPKQLRQGYVFNIEAGKKALSNINSLGLFSNIEVNPRPDEKNEGGIIVEIKLKELEQKSAEVSTEWSIVP 463
gi 499174555 435 RTRDFIITREMR--LKPGDVFNRNRAQTDLQRVYSLGLFEDVRLSFNPGS-DPTEVIVNVDVVEGNTG--------SIAA 503
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    455 GRGGRPTLASLQPGGTITFEHRNLQGLNRSLTGSVTTSNFLNPQDDLAFKMEYAHPYLDGVDNPRNRTLRVSCFNSRKLS 534
gi 5541685   464 GRGGAPTLASFQPGGSVTFEHRNLQGLNRSLMGSVTTSNFLNPQDDLSFKLEYVHPYLDGVYNPRNRTFKTSCFNSRKLS 543
gi 499174555 504 GGG---ISSSSGLFGTISYQERNLGGNNQTIGVEAQVG-----QRELLFDVSFTDPWIGGD--PFRTSYTANLFRRRTIS 573
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    535 PVFTGGPG----VDEVPSIWVDRAGVKANITENFSRQSKFTYGLVMEEIITRDESNHICSNGQRVLPNGAIS-ADGPPTT 609
gi 5541685   544 PVFTGGPG----VEEVPPIWVDRAGVKANITENFTRQSKFTYGLVMEEITTRDESSHIAANGQRLLPSGGIS-ADGPPTT 618
gi 499174555 574 LVFDGADSsirtFNGFDSPRVVRTGLGLTFFRPIADDVFAPPDWRLSAGFGYQNVRIENAAGALSPFSAPLNgFNSQPLS 653
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    610 LSGTGIDRMAFLQANITRDNTRFVNGTIVGSRNMFQVDQGLGVGSNFPFFNRHQLTVTKFLQLMSVEEG----AGKSPPP 685
gi 5541685   619 LSGTGVDRMAFLQANITRDNTKFVNGAVVGQRTVFQVDQGLGIGSKFPFFNRHQLTMTKFIQLREVEQG----AGKSPPP 694
gi 499174555 654 FSDYGVDELFTLSFGASQDNRNNALQPTSGSLVRFGAEQTIPVGTGNIMMTRLRGSYSYYIPVNWLDLTgfglVESTQPQ 733
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 576507    686 VLVLHGHYGGCVGDLPSYDAFTLGGPYSVRGYNMGEIGAARNILELAAEIRIPIKGTH-VYAFAEHGTDLGSSKDVKGNP 764
gi 5541685   695 VLVLHGHYGGCVGDLPSYDAFVLGGPYSVRGYNMGELGAARNIAEVGAEIRIPVKNTH-VYAFVEHGNDLGSSKDVKGNP 773
gi 499174555 734 TVAFNVQAGTVLGDLPPYEAFILGGSNSVRGYQEGELGNGRSFFQATAEYRFPIIAAVgGALFVDYGSNLGSQGAVPGFP 813
                        730       740       750       760
                 ....*....|....*....|....*....|....*....|....*...
gi 576507    765 TVVYRRMGQGSSYGAGMKLGLVRAEYAVDH---NSGTGAVFFRFGERF 809
gi 5541685   774 TAVYRRTGQGSSYGAGVKLGLVRAEYAVDH---NNGTGALFFRFGERY 818
gi 499174555 814 AIVRGLPGSGVGYGLGVRIQSPVGPIRIDLgftGEGESRINFGIGEKF 861
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap