Conserved Protein Domain Family
ispZ

?
TIGR00997: ispZ 
intracellular septation protein A
This partially characterized protein, whose absence can cause a cell division defect in an intracellularly replicating bacterium, is found only so far only in the Proteobacteria. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 130070
View PSSM: TIGR00997
Aligned: 8 rows
Threshold Bit Score: 150.177
Threshold Setting Gi: 8134519
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134516    9 IKPFLDWIPLIVFFYIYKTTEgegsehIIAATTGLLIATLIVYGLMFVLQKfTLEKRQWLVVVLTVVFGGLTMAFQDDFY 88
gi 140428     1 MKQFLDFLPLVVFFAFYKIYD------IYAATAALIVATAIVLIYSWVRFR-KVEKMALITFVLVVVFGGLTLFFHNDEF 73
gi 1175671    1 MKKILNLLPIFTFFIFYRFYD------IFIASKSLIFISGLTCLLYWIIYK-EIDKINLFSFITIAIFGSLTIIFHNSQF 73
gi 1175672    1 MKQLLDFIPLILFFITYKLGG------VREAAIVLVVATILQIVILKWKYG-MVEKQQKIMASAVVFFGLLTAYFNEIRY 73
gi 48474970   1 MKFVSDLLSVILFFATYTVTKn-----MIAATAVALVAGVVQAAFLYWKYK-KLDTMQWVGLVLIVVFGGATIVLGDSRF 74
gi 8134519    2 LKLLSEIGPVIAFFAGFFYGGg-----IQNATLYMLITSIICITLCYIIDK-KVSKLSIISSTVLFISGIITLISGDSMY 75
gi 152079     1 -KLATELGPLLVFFFVNAKFN------LFAATGAFMVAIVAAMIASYVVTR-HIPIMAIVTGVIVLVFGTLTLVLHDETF 72
gi 5932366   20 VKMAIDLRPLVIFSLAYKMTG------SFIGTIAFMVSMIVAIGVSRYKLG-RVSPTLWLSFVLIMFFGGLTLWFHDQRF 92
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8134516   89 IRLKAPIINAVFAFGLAMSPLFLGgTPGIQKMLGPIFE-MTPKQWMKLNWVWVGFFTLMAVLQALFAFVW-VEYWAMFTA 166
gi 140428    74 IKWKVTVIYALFAGALLVSQWVMK-KPLIQRMLGKELT-LPQPVWSKLNLAWAVFFILCGLANIYIAFWLpQNIWVNFKV 151
gi 1175671   74 IKWKITIIYMIFSVILFISQFFMK-KPIIQRFLEKDIK-ISDLYWKKINFFWALFFLFCSILNIYVALCLpEKIWVNFKV 151
gi 1175672   74 LQWKVTIINGLFAIVLLVAQFQFK-TPLIKKLLGKELQ-LPEKAWNTLNFGWAIFFIICMLVNIYISHNMsEEAWVDFKS 151
gi 48474970  75 IMWKPSVLFWLGALFLWGSHLAGK-N-GLKASIGREIQ-LPDAVWAKLTYMWVGFLIFMGIANWFVFTRF-ESQWVNYKM 150
gi 8134519   76 IKIKPTILYVIFGIIFLMSGIKKN--PFIKYALESIVR-LKEESWIILSYRTAAFFFFMAVVNEVVWRNFsDETWVKFKV 152
gi 152079    73 IKVKPTIIYGLFAAILGGGLLFGR--SFIAVMFDQMFN-LTPQGWRILTLRWALFFAGMAVLNEIVWRTQsTDFWVNFKV 149
gi 5932366   93 IQLKPTIIYSYFAVMLLGGRLLNK--PMLKYIMEDAFDgVTEKGWLILSFNWGCFFLVMALLNEYLRTHFsFDVWLTLKI 170
                       170       180
                ....*....|....*....|....*..
gi 8134516  167 FGDMIVMVVFMVAQFWFLRGFMRKDIK 193
gi 140428   152 FGLTALTLIFTLLSGIYIYRHMPQEDK 178
gi 1175671  152 FGLSFLMFLSILITSIYINFKMLKEK- 177
gi 1175672  152 FGIIGMTVIATIISGVYIYRYLPKDGS 178
gi 48474970 151 FGSTALMLVFFIIQGIYLSTCLKKED- 176
gi 8134519  153 FGVIPITFIFILLQLPLLLKNKLPDSK 179
gi 152079   150 FGVTPITMIFAIAQMPLTKRYHLEPVS 176
gi 5932366  171 WGAMILSAVFGFANMPVLIKNGLNTGN 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap