2H2W


Conserved Protein Domain Family
metA

?
TIGR01001: metA 
Click on image for an interactive view with Cn3D
homoserine O-succinyltransferase
The apparent equivalog from Bacillus subtilis is broken into two tandem reading frames. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 130074
View PSSM: TIGR01001
Aligned: 5 rows
Threshold Bit Score: 488.586
Threshold Setting Gi: 6969141
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2H2W_A        13 MPINVPSGLPAVKVLAkEGIFVMTEKRAIHQDIRPLEILILNLMPDKIKTEIQLLRLLGNTPLQVNVTLLYTETHKPKHT 92
gi 6969141     1 MPLIIPENIPAYELLK-EHAFIMGLRRAKHQDIRPQEILIVNLMPKKIETENQILSLLANSPLQVNITLLATTSYVGKNT 79
gi 9656123     7 VPIRIPDQLPASDVLRnENIFVMSESRASTQEIRPLKVLLLNLMPKKIETETQFLRLLSNSPLQVDIELLRIDDRPSKNT 86
gi 447045523   1 MPIRVPDELPAVNFLReENVFVMTTSRASGQEIRPLKVLILNLMPKKIETENQFLRLLSNSPLQVDIQLLRIDSRESRNT 80
gi 12230320    1 MPINVPSGLPAVKVLAkEGIFVMTEKRAIHQDIRPLEILILNLMPDKIKTEIQLLRLLGNTPLQVNVTLLYTETHKPKHT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2H2W_A        93 PIEHILKFYTTFSAVKDRKFDGFIITGAPVELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYEL 172
gi 6969141    80 PFTHLEKFYKGLEEVKKHKFDGAIVTGAPVEQMDFEKVAYWEELLEIFDFLKQNVTSSMYICWGAMAALKYFYGVDKISL 159
gi 9656123    87 PEEHLNTFYRQFELVKNRNFDGLIITGAPLGLVQFEDVAYWQHLQNIMAWAKAHVTSTLYICWAAQAGLKLLYNLPKRTR 166
gi 447045523  81 PAEHLNNFYCNFEDIQDQNFDGLIVTGAPLGLVEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTR 160
gi 12230320   81 PIEHILKFYTTFSAVKDRKFDGFIITGAPVELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYEL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2H2W_A       173 PQKLSGVYKHRVA-KDSVLFRGHDDFFWAPHSRYTEVKKEDIDKVP---ELEILAESDEAGvyVVANKSERQIFVTGHPE 248
gi 6969141   160 DKKIFGVYKHDKV-SPDLLLTNLDEKVLMPHSRHSSMDEEQILALQkqgKLKILLRNKKIG--SALLRDEKNIFILGHLE 236
gi 9656123   167 EEKLSGVYYHDIHkPFHPLLRGFDDRFLAPHSRYADFDAEFLAEHT---DLDILATSDVAGvyLAATKDKRNVFVTGHPE 243
gi 447045523 161 TEKLSGVYEHHILhPHALLTRGFDDSFLAPHSRYADFPAALIRDYT---DLEILAETEEGDayLFASKDKRIAFVTGHPE 237
gi 12230320  161 PQKLSGVYKHRVA-KDSVLFRGHDDFFWAPHSRYTEVKKEDIDKVP---ELEILAESDEAGvyVVANKSERQIFVTGHPE 236
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
2H2W_A       249 YDRYTLRDEYYRDIgrnlKVPIPANYFPNDDPTKTPiltWWSHAHLFFSNWLNYCIYQKTPYRL 312
gi 6969141   237 YFKETLHQEYVRDN----FIQKAKNYYDKKGNIKYN---WRSNANTIFANWLNYDVYQSTPFVL 293
gi 9656123   244 YDAYTLHGEYVRDLgeglNPAIPVNYYPNDNPDNKPcasWRSHGHLLFANWLNYCVYQQTPYDL 307
gi 447045523 238 YDAQTLAQEFFRDVeaglDPDVPYNYFPHNDPQNTPrasWRSHGNLLFTNWLNYYVYQITPYDL 301
gi 12230320  237 YDRYTLRDEYYRDIgrnlKVPIPANYFPNDDPTKTPiltWWSHAHLFFSNWLNYCIYQKTPYRL 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap