Conserved Protein Domain Family
polys_exp_MPA1

?
TIGR01006: polys_exp_MPA1 
polysaccharide export protein, MPA1 family, Gram-positive type
This family contains members from Low GC Gram-positive bacteria; they are proposed to have a function in the export of complex polysaccharides. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 130079
View PSSM: TIGR01006
Aligned: 8 rows
Threshold Bit Score: 274.339
Threshold Setting Gi: 729016
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3411122    1 MNQDNTktksvEIDILALLHKLWTKKLLILFIAFYFAAFSFLGTYFFIQPTYTSTTRIYVVNQATDNN-NLSAQDLQAGT 79
gi 3907601    2 MKEQNTi----EIDVFQLLKTLWKHKLIILLVALVTGAGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKpGLTNQDLQAGT 77
gi 3320388    1 MKEQNTi----EIDVFQLFKTLWKRKLMILIVALVTGTGAFAYSTFIVKPEYTSTTRIYVVNRNQGDKpGLTNQDLQAGT 76
gi 28201777   1 MKEQNTl----EIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSMTRIYVVNRDQGEKsGLTNQDLQAGS 76
gi 1276876    1 MNQDNTks--dEIDVLALLHKLWTKKLLILFTAFYFAVFSFLGTYFFIQPTYTSTTRIYVVNQATDNK-NLSAQDLQAGT 77
gi 729016     1 --MEST------IDLSELLGRVRKNMKLLIILPLLGLLISAIISFFFLDVKYQASTQILVNQ-KGNDS-QIMAQEVQSNI 70
gi 1773340    1 --MEST------LELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP-QFMAQEVQSNI 71
gi 2072438    3 ETQEQT------IDLRGIFKIIRKRLGLILFSALIVTILGSIYTFFIASPVYTASTQLVVKLPNSDNS-AAYAGEVTGNI 75
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3411122   80 YLVNDYKEIITSNDVLSEVIKDEKLNLSEAELAKMISVNIPTDTRLISISVNAKTGQDAQTLANKVRKVASGKIKKVTKV 159
gi 3907601   78 YLVKDYREIILSQDVLEKVATNLKLDMPAKTLTSKVQVTVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIIAVTRV 157
gi 3320388   77 YLVKDYREIILSQDALEKVATNLKLDMPAKTLASKVQVAVPADTRIVSISVKDKQPEEASRIANSLREVAAEKIVAVTRV 156
gi 28201777  77 SLVKDYREIILSQDVLEEVVSDLKLDLTPKDLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRV 156
gi 1276876   78 YLANDYKEIIASNDVLSEVIKDEKLNLSEAELSKMVSVNIPTDTRLISISVNAKTGQDAQTLANKVREVASKKIKKVTKV 157
gi 729016    71 QLVNTYSEIVKSPRILDKVSKELDDKYSRSEISSMLTVTNQAESQVLNIDVESKSGSNSEKIANKIAEVFSDEVPDIMNV 150
gi 1773340   72 QLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLSSMLTITNQENTQLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIMSV 151
gi 2072438   76 QMANTINQVIVSPVILDKVRSNLN--LSDDSFQKQVTAANQTNSQVIMLTVKYSNPYIAKKIADETAKIFSSDAAKLLNV 153
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 3411122  160 EDVTTLEEAKLPESPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVRRPEDVED----VLGMTLLGIIPDTDK 231
gi 3907601  158 SDVTTLEEARPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVKRPEDVED----VLQMPLLGVVPDFDK 229
gi 3320388  157 SDVTTLEEARPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVKRPENVEN----VLKIPLLGLVPDFDK 228
gi 28201777 157 SDVTTLEEARPATSPSSPNIKRSTLIGFLAGVIGTSVIVLILELLDTRVKRPKDIED----TLQMTLLGIVPNLNK 228
gi 1276876  158 EDVTTLEEAKLPESPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRVRRPEDVED----ALGMTLLGIVPDTDK 229
gi 729016   151 DNVSVLSTADNTGKQVAPKPMVNLVVGLVIGLVIALLIIFIKEVFDKRIKTEEEVEN----ELVIPVLGSIQKFD- 221
gi 1773340  152 DNVSILSKADGTAVKVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIKDEEDVEK----ELGLPVLGSIQKFN- 222
gi 2072438  154 TNVNILSKAKAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKINKEEDIEAlgltVLGVTSYDQMSDFNK 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap