1VS5


Conserved Protein Domain Family
rpsC_bact

?
TIGR01009: rpsC_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S3, bacterial type
This model describes the bacterial type of ribosomal protein S3. Chloroplast and mitochondrial forms have large, variable inserts between conserved N-terminal and C-terminal domains. This model recognizes all bacterial forms and many chloroplast forms above the trusted cutoff score. TIGRFAMs model TIGR01008 describes S3 of the eukaryotic cytosol and of the archaea. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130082
View PSSM: TIGR01009
Aligned: 16 rows
Threshold Bit Score: 291.143
Threshold Setting Gi: 133936
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VS5_C         1 MGQKVHPNGIRLG--IVKPWNSTWFANT-KEFADNLDSDFKVRQYLTKELA--KASVSRIVIERPAKS-IRVTIHTARPG 74
gi 6226102     1 MGQKVCAHGFRVGptLIKDWDSILYA-E-KHYKTLFIQDLKIRDLINKWFN--QAQISRVLIERPSNKsIIININAKKPN 76
gi 6647794     1 MGQKTHPIGFRLG--VIKEWPSKWYAPK-KEYSKLLHEDLKIKNYIKERYK--VAGVSKVEIERIVDK-VRVKIHTARPA 74
gi 3915862     1 MGQKVHPYSLRVK--INKDWKSKWYFDK-KLYSAILHEDFLIRREIMKFLKgiKFDISDIEIIRNNPQkVTVVIVTPRPG 77
gi 6094180     1 MGQKVSPIGLRLG--INKVWSSRWYAGP-REYAALLHEDLRIRSMIRSFPEckNADIAEVEIVR-HPQrVTVVMHTARPG 76
gi 786159      1 MGQKVNPVGLRIG--VIRDWESKWYAG--KDYADFLHEDLKIREYISKRLS--DASVSKVEIERAANR-VNITIHTAKPG 73
gi 576413397   1 MGQKINPHGFRLG--ITTDWKSRWYAD--KQYAEYVKEDVAIRRLLSSGLE--RAGIADVEIERTRDR-VRVDIHTARPG 73
gi 499176941   1 MGQKVNSNGLRFG--INKNWISRWTANShAQTAKWLIEDEKIRNLFFVNYR--NAQVSNVEIERTQAT-VDVFVYAAQPA 75
gi 497571657   1 MGQKVNSNGLRFG--INKNWISRWTASSnQQTATWLVQDEKIRNLFFINYR--NAQVSNVEIERTQTT-VDVYVYAAQPA 75
gi 662705076   1 MGQKIHPVGFRLG--ITKDHKSCWYADP-KRYPELLQEDHKIRQYIEKTLN--NAGISDIRIERKAEQ-IELGIHTARPG 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VS5_C        75 IVIGKKGEDVEKLRKVVADIAG--V--PA--QINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRL-GAK 147
gi 6226102    77 IIIGKNGTEIDKLKKAIENMTFl-K--EV--YINIHEVRKFNIDAAIVAQTIAAQLEKRVSFRKAMKTAIQASFKQ-GGQ 150
gi 6647794    75 IVIGRRGQEVENLKKTLEKMLPg-K--EI--TISVVEVRVPELDAQLVAQDIATQIERRVSHRRAMKRAIDNALKA-GAK 148
gi 3915862    78 SVIGLKGSNLEKIGQLLTKKIS--K--KI--SIKIKEVKRPELDAQIIANGIAKQVENRASYRKVLKSSLSTSMLK-GAQ 150
gi 6094180    77 VVIGAKGVNIEKIGAEVQKRLN--K--KV--QIKVKEIKRMELNAYLVAQNVARQLTARVSFRKCLRQACAGTMKS-GAQ 149
gi 786159     74 MVIGKGGSEVEALRKALNSLTG--K--RV--HINILEIKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRA-GAQ 146
gi 576413397  74 IVIGRRGTEADRIRADLEKLTG--K--QV--QLNILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQpNVK 147
gi 499176941  76 FLIGSENKNIQKITKQIKQIIG--RttNL--DLTINEIGSPMLSARIIARDLANAIEARVPLRTAMRQSLIKVLKA-GAN 150
gi 497571657  76 LLIGSENKNIQKITKMIQIIVG--R--KIklDLTINEIGSPMLSSRIIARDIANAIENRVPLRSAMRQALTKVLKA-GAN 150
gi 662705076  75 VVVGRGGSGIEQLREGLQKLLGsaR--QI--RVNVIEVPNADADAALMAEYIGQQLERRVSFRRVVRQALQRAERA-EVK 149
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
1VS5_C       148 GIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGM 211
gi 6226102   151 GIRVSCSGRLGGAEIARTEWYIEGRMPLHTLRADIDYSTAEAITTYGVIGVKVWIYKGEYKENK 214
gi 6647794   149 GVKVQVKGRIGGAELARKEWFLVGRMPLQTLRADIDYGFATAYTKYGILSVKVWIYKGDVLNGR 212
gi 3915862   151 GLKIKIAGRLGGAEIARSFEVKEGRVPLHTLRANIDYGFSEAQTTYGIIGVKVWLFKGEVLGRQ 214
gi 6094180   150 GVKIRVSGRLGGAEMSRTEEIKEGRTPLHTLRADIDYGFAEAHTTYGSIGVKVWLYSGMMYGNE 213
gi 786159    147 GVKTMVSGRLGGADIARPEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVLPTK 210
gi 576413397 148 GIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGK 211
gi 499176941 151 GIKVLVSGRLNGAEIARDKMYIEGNMPLSTLRADIDYALEKAQTTYGVIGVKVWINRGMIYTKG 214
gi 497571657 151 GIKVLVSGRLNGAEIARDKMYIEGNMPLSTLRADIDYAFEKAKTTYGIIGVKVWINRGMIYAKG 214
gi 662705076 150 GIKIQVSGRLNGAEIARTEWVREGRVPLHTLRADIDYAYRTALTTYGILGIKVWIFKGEVIPGQ 213
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap