Conserved Protein Domain Family
BexC_CtrB_KpsE

?
TIGR01010: BexC_CtrB_KpsE 
polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family
This family contains gamma proteobacterial proteins involved in capsule polysaccharide export. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 130083
View PSSM: TIGR01010
Aligned: 8 rows
Threshold Bit Score: 444.161
Threshold Setting Gi: 213580404
Created: 7-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4809244    25 KKLNPLFWVTVAIPTVLSAFYFGSVASDIYISESSFVVRSPKNQTALTGVGALLQGSGFSRAQDDTYTVQEYMHSRTALE 104
gi 114927     18 KKMKPLFGLTVLIPTAFSAVYFGLFASDIYVSESSFVVRSPRSQSSLSGVGALLQSTGFSRSQDDTYSVQEYMRSRTALS 97
gi 6424987    10 AN--PLLWLTVIIPTACSGIYYSLFASDIYVSESSFWFRSPNNQSSLTGVGALLQNSGFARSQDDTYSVQEYMRSRTALE 87
gi 3435192    19 RKISTLFKYMVILPTCCSLFYFSLWASDIYISQSSFVVRTPKNQAALSGVGALLQSSGFARAQDDTYTVQEFMRSRSTLE 98
gi 399313     27 KKLSPLFWVTVIIPTVISLVYFGFFASDRFTSQSSFVVRSPKSQSSLNGLGAILQGTGFARAQDDIYTVGEYMRSRSSLD 106
gi 2801420    58 KSLQLGSFLWVVICFSIAVLYFGFIASDRYVSRAELMIKQADQVKMLPDALSMLGIGGSN--HQDILLVQDYMKSWDMLA 135
gi 1170708    23 DIQKHLAKIIILAPMAMLLIYLAIFSQPRYMSESKVAIKRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLA 102
gi 446353820  78 KQSLRRLFLYIALPLLVIMLMSWILTSHFYSADATFIVQTDASQDNFSGTSFFGAGNKMS----EGFQVREFILSKEMMD 153
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4809244   105 QLMKDLPIREYYENQGDIIARFNGFGL-NNSKEAFYKYFRDRLSVDFDSVSGIASLRIRAFNAEEGQQINQKLLAEGETL 183
gi 114927     98 ALEQGLPLRTFYSEKGDLLSRFNGFGL-NDTQEAFYRYFKERLSVDVDSISGIATLRVHAFDAEEGYQINERLLKEGESL 176
gi 6424987    88 QLEAEIPVKRFYSEQGDLLSKFNGLGF-NDTQEAFYRYFKERLNIDVDSISGIATLRVRAFNAEEGQKINENLLQQGETL 166
gi 3435192    99 LLEKSIPIRQFYEDKGDLFSRFNPLNI-FSEQEAFYQYFSKKLSVNFDSVSGIATLNIRAFDPKEAQQINQELLKQGEYL 177
gi 399313    107 ELRKILPVREFYETKGDAFSRFNGFGF-RGEEEAFYQYYKNQVMINFDTVSGISTLNVTSFDALESKKINEALLKQGEAL 185
gi 2801420   136 KLNKELALKAHFQS--DSADYFSRLHK-GVSREDFLDYYRKHLTLHLDELSGVLTVELQTFDPQYGQRVVELMLKESERF 212
gi 1170708   103 ALDKQLNFREAFSHSG--LDFLNHLSK-DETAEGFLKYYKDRINVSYDDKTGLLNIQTTGFSPEFALKFNQTVLKESERF 179
gi 446353820 154 RMEKELGFLSYFAQ--DDIALFSRFHApLGINDDPYRYYLSKVSVAVDIQQGMLRLNVKARSAKQAEFFAQRILSFAEQH 231
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4809244   184 INRLNERARKDTISFAEQAVKEAENNVNATASDLSKYRIKNKIFDLPAQSGVQLSLISSLKSELIRVETQLAQLQSITPD 263
gi 114927    177 INRLNERARKDTIEFAEQAVKDAEKNVNETAQALSQYRIKNKIFDLPAQSGVQLSLISSLKSELIRVETQLAQLVSITPD 256
gi 6424987   167 INRLNERARQDTVEFAEERVKEAEKDVNNTALALSQYRTKNKIYDLPAQSSVQLSLISTLKSELIRVQTQLAQLKSITPD 246
gi 3435192   178 INRLNERARKDTVMFAELAVSEAEKKVTETSSALSEYRIKNGVFDLQSQSEVQLSLISTLQNELITIQTQLDQVRSISPN 257
gi 399313    186 INQLNDRARADTVRYAEEVVKTAAERVKEASQNLTDYRIANGVFDLKAQSEVQMGLVSKLQDELIVIQTQLDQVKAVTPE 265
gi 2801420   213 INKLGHQVALEQLAFVEKEVNRAYQRLQDEKAKVLAFQNSHQLLSPESTSSARLGVVSQIEGELVRQQAELKQLRSYMKE 292
gi 1170708   180 INEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNVLDPQAQAQAASTLVNTLMGQKIQMEADLRNLLTYLRE 259
gi 446353820 232 VNTVSARMQKERILWLENDVKSAQENLGAARLELLKIQHIQKDIDPKETITAIYQLIAGFETQLAEAKAEYAQLMVNGLD 311
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4809244   264 -NPQVDALLMRQKSLRKEIDEQSKQLSSNs-NSSIAIQTADYQRLVLANELAQQQLTAALTSLQNTKNEADRQQLYLEVI 341
gi 114927    257 -NPQVPALQMRQKSLKKEIDEQTRQLSGN--GNSAATQTADYQRLMLANELAQQQLAAAMTSLQNTRGEADRQQLYLEVI 333
gi 6424987   247 -NPQVAALQMRQKSLKKEIDDQSKQLAGG--NTSVATQTAEYQRLVLANELAQQQLAAAMTSLQNTRGEADRQQLYLEVI 323
gi 3435192   258 -NPQVQTLLARANSIRKEMQQQVQQVLGG--GNSIVTQTAEYQRLVLNNTLAQQQLGTAITSLQNARSEADRQQLYLEII 334
gi 399313    266 -NPQIPGLQAREQSLRKEIDQQLRAISGGg-HSSLSNQAAEYQRVYLENQLAEQQLAAAMTSLESAKVEADRQQLYLEVI 343
gi 2801420   293 tAPAVVSLQGRVDALTKQLEQERAKLTGQd-NDAMNEITAGYMDVQTQATLAADLYKTGLISLEQTRVEAYRKLKHLLVI 371
gi 1170708   260 dAPQVVSARNAIQSLQAQIDEEQSKITAPq-GDKLNRMAVDFEEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVI 338
gi 446353820 312 qNPLIPRLSAKIKVLEKQIGEQRNRLSNKlgSQGSSESLSLFEDLRLQSEIAKARWESALQTLQQGKLQALRERQYLLII 391
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
gi 4809244   342 SQPSKPDWAEEPYRLYNILATFFIGLMLYGVLSLLIASVREHKN 385
gi 114927    334 SQPSKPDWALEPSRIYNIIATFIIGLMLYGVLNLLIASIREHKN 377
gi 6424987   324 GRPSKPDWALEPYRIYNIISTFFIGLILFGVLSLLLASIREHKN 367
gi 3435192   335 SYPNEPDLALEPYRLYNILATLFISLILYGITLLLLASIREHKN 378
gi 399313    344 SQPSLPDLAHEPKRLYNIVATLIIGLMVYGILSLLTASIREHKN 387
gi 2801420   372 TQPTLAEDAEYPRRLYNLATVGVLLCLFYGLIIMGLATLREHQD 415
gi 1170708   339 SSPQLPQESSFPNIPYLIACWLLVCCLLFGTLKLLLAVIEDHRD 382
gi 446353820 392 SQPMAESDTTRYADGTKWLLFFVLLGITYLVTSLLITIRRMRE- 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap