1P87


Conserved Protein Domain Family
rpsB_bact

?
TIGR01011: rpsB_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S2, bacterial type
This model describes the bacterial, ribosomal, and chloroplast forms of ribosomal protein S2. TIGR01012 describes the archaeal and cytosolic forms. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130084
View PSSM: TIGR01011
Aligned: 15 rows
Threshold Bit Score: 352.778
Threshold Setting Gi: 1350974
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P87_B         2 TVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKD 81
gi 6094174     3 VVTIKNLLESGVHFGHQVRRWDPRMKKYIFAERNGIHIIDLQKTITAIREAYDMVRRTVSSGKSVLFVGTKKQSQQTIAK 82
gi 1710759     3 VVTMKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTFIDKAYEFVKETVAHGGSVLFVGTKKQAQESVAA 82
gi 2500390     3 VVSLADLLESGVHFGHQTRRWNPRMDQYIYTARNGVHIIDLVQTAQLMEDAYEYVRSSTINGKKFLFVGTKRQAAGIISQ 82
gi 2500388     1 MVTMKDLLECGVHFGHQTRRWNPKTKKFIFGVRKNIHIIDLQKTLRYFRYTYNIVRDASAQGKSIMFVGTKKQANETLKE 80
gi 6226099     6 PINIKELLDAGVHFGHKTSRWNPKMASYIYGERDDVHIIDLRQSAALMSVALNAIYETVKKDGKILFVSTKIQASDIIAE 85
gi 6707743     7 KLTIKDLMSAGAHFGHQTRRWNPKMKLYIFEEKNGLYIINLAKTLQQLRNALPHIRKVIQDNKTVLFVGTKKQAKCVIRE 86
gi 6831542     6 TLTLKELLESGAHFGHQTSRWNPRMKPFIFEEKNGLYIIDLAKTLAQLKKAVACIQTTIGQEKSILFVGTKKQAKQIIRE 85
gi 485669584  68 TVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKD 147
gi 491873693   3 QVSMRDMINAGVHFGHQTRYWNPQMKPFIFGARNGVHIINLEKTLPLFNEALAELTRIASNNGKVLFVGTKRAASEAVQA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P87_B        82 AALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQd-GTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDAL 160
gi 6094174    83 EAQRCGMFYVTNRWLGGMLTNFSTIRKSLSRLKKIERMEId-GTFEHLSKKEVASLRKEHAKLEKNLGGIKEMKELPGVV 161
gi 1710759    83 EATRVGMPYVNQRWLGGMLTNFSTVHKRLQRLKELEAMEQt-GGFEGRTKKEILGLTREKNKLERSLGGIRDMAKVPSAI 161
gi 2500390    83 EAQRCGAHYVNQRWLGGMLTNWETIRKRVDRLKELEALEAs-GGIDRRGKKEGSMLRRELGKLQKYLGGIKNMRKLPDVV 161
gi 2500388    81 FAESIQVPYVNYRWLGGMLTNFSTIRKSVRKLEIIEEMENs-GQIDLLTKKEKLMILRKKEKLDKYLGGVRHMKKIPDMI 159
gi 6226099    86 YAEKCGQYYVNNRWLGGMLTNWKTIACSIEKLEKLEKTLEseEARICYTKKEILDMSRKKDKLLLSLAGIRNLNSKPDLL 165
gi 6707743    87 AAIEAGEFFIAERWLGGMLTNMTTIRNSIKTLDKIEKDLS--RNQAYLTKKEAALLAKRHQKLLRNLEGIRYMKKAPGLL 164
gi 6831542    86 AAIECGEFFASERWLGGMLTNMATIRNSVKTLNRIELDLE--ASNSGLTKKELALLAKRHRKLLNNLEGVRHMNSLPGLL 163
gi 485669584 148 AALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQd-GTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDAL 226
gi 491873693  83 AALDCQQYYVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQd-GTFDKLTKKEALMRSREMEKLELSLGGIKDMGGLPDAL 161
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
1P87_B       161 FVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQ 226
gi 6094174   162 FIIDTRKETIAIREARRVGIPIVAVVDTNCNPEGIDYPIPGNDDAIRAISLFTQLIANAVMEAGNE 227
gi 1710759   162 WVVDTNKEHIAVGEARKLGIPVIAILDTNCDPDEVDYPIPGNDDAIRSAALLTRVIASAVAEGLQA 227
gi 2500390   162 VIVDQRREHNAIHECQKLGIPIIAMLDTNCDPDVVDVPIPANDDAIRSIKLIVGKLADAIYEGRHG 227
gi 2500388   160 FVIDVAKEKIAVAEARKLHIPIVAPLDTNCDPDLVDYPIPGNDDAIRSIRLFCKEMSEAILEGREL 225
gi 6226099   166 VVIDTNKEHIAINEAVKLNIPVVAVVDTNSNPDNVDYPIPGNDDSIRSIRLYCSLFADAALQGLEE 231
gi 6707743   165 VVVDPSYEKIAVAEAKKLGIPVLALVDTNCDPTPIDHVIPCNDDSLKSIRLIINVIKENIIEAKHK 230
gi 6831542   164 IVIDPGYERIAVAEAGKLGIPVMALVDTNCDPTPINHVIPCNDDSMKSIRLIVNVLKDAVIDAKKR 229
gi 485669584 227 FVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQ 292
gi 491873693 162 FVIGADHEHIAVKEANNLGIPVFAIVDTNSTPAGVDFVIPGNDDATRAIQLYVSAAAAAVKEGRGN 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap