Conserved Protein Domain Family
rpmJ_bact

?
TIGR01022: rpmJ_bact 
ribosomal protein L36, bacterial type
Proteins found by this model occur exclusively in bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130094
View PSSM: TIGR01022
Aligned: 8 rows
Threshold Bit Score: 37.4636
Threshold Setting Gi: 7674319
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30
                ....*....|....*....|....*....|....*...
gi 7674319    1 MKVQASVKKRCEHCKIIRRKKRVYVICKVnPKHNQKQG 38
gi 1350734    1 MKVRASVKPICKDCKIIKRHRILRVICKT-KKHKQRQG 37
gi 6094067    1 MKIRTSVKVICDKCKLIKRFGIIRVICVN-PKHKQRQG 37
gi 7674325    1 MKVRPSVKKMCDKCKIIKRRGVIRVICAT-PKHKQRQG 37
gi 1173040    1 MKVRASVKKMCRNCKIVKREGVVRVLCSD-PKHKQRQG 37
gi 132921     1 MKVRPSVKPICEKCKVIRRKGKVMVICEN-PKHKQKQG 37
gi 499182445  1 MKVRSSVKKRCAKCKIIRRKGRVMVICEI-PSHKQKTG 37
gi 499192217  3 MKVRVSVKPICEKCKVIKRKGVLRIICDN-LKHKQRQK 39
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap