1VS6


Conserved Protein Domain Family
rplT_bact

?
TIGR01032: rplT_bact 
Click on image for an interactive view with Cn3D
ribosomal protein L20
This model describes bacterial ribosomal protein L20 and its chloroplast equvalent. This protein binds directly to 23s ribosomal RNA and is necessary for the in vitro assembly process of the 50s ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit. GO process changed accordingly (SS 5/09/03) [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130104
View PSSM: TIGR01032
Aligned: 13 rows
Threshold Bit Score: 135.585
Threshold Setting Gi: 16273230
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VS6_Q         2 ARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGISYSKFIN 81
gi 1350687     1 MRVKGTNTTRIRRKKWLKQASGSFGTRKASFKAAKQTVIQASKYAYRDRRQKKREFRSLWILRLNAALRAQGMTYSVFIN 80
gi 1350688     2 TRVKRGNVARKRRKKILKLAKGFRGSHSKLFRTANQQVMKALRNAYRDRRKRKRDFRRLWITRINAAARQEGMSYSKLTG 81
gi 7674207     1 MRVKRAVHAKKKRKKYLKAAKGYRGALSRRYKLAKQMYVRSKWYSYVGRKQKKRDMRKLWITRINIAARNEGLKYSELIH 80
gi 6225976     2 TRAKSGKISKKRHKKILKLAKGYRGRANNCFRVAIEKVEKGLQYAYRDRRNRKRDFRGLWIQRINAAVREHGLIYSQFMG 81
gi 7674219     1 MRVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWVVRINAACRMHNTSYSRFMH 80
gi 3914716     2 ARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLXKGMMYATRDRKVRKRDFRRLWISRISAALSDTGVTYSRFIE 81
gi 7674202     2 VRATGSVASRSRRKRVLKQAKGFWGDRKGHFRQSRSSVMRAMAFNYMHRKDRKGDFRSLWITRLSVASRIHGLSYSRLIN 81
gi 7674213     2 VRATGSVASRRRRKRILKQAKGFWGDRKGHIRQSRSSVMRAMAFNYMHRKDRKGDFRSLWIARLNVASRIHSLSYSRLIN 81
gi 6094027     2 SRSLSSNGRVRRRKRILKLAKGFRGRCGTNYKAAKDAVSKALAHSYVARRDRKGSMRRLWISRINASVRTQGLSYSRFMN 81
gi 669215574 843 ARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGISYSKFIN 922
gi 491782491   2 ARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGLSYSKFIN 81
gi 2500291     1 MRIKGGKQTRVRRKKWLKQASGSFGTRHASYKVAKQTVIQAAKYAYRDRRNKKRDFRSLWILRLNAALREQGMTYSVFIN 80
                         90       100       110
                 ....*....|....*....|....*....|...
1VS6_Q        82 GLKKASVEIDRKILADIAVFDKVAFTALVEKAK 114
gi 1350687    81 ELKKAKIVINRKVLSELAIKEPNKLNLIINTIK 113
gi 1350688    82 QLKKANIEINRKMLAQLAVLDPAAFSEVVKVAA 114
gi 7674207    81 GLKLAGVSINRKMLSELAVNDPEAFKEYVKIAK 113
gi 6225976    82 ALKKAGINIDRKVLAELAVNNNDGFASIVQQSK 114
gi 7674219    81 ALKVANIELDRKVLADMAMNDMQAFKSVLESVK 113
gi 3914716    82 GLLKSNIKINRKILSNLAIEDVEAFKKIVLEIR 114
gi 7674202    82 GLKQAGIHLNRKMLSEMAIHDPQGFAVVATQAK 114
gi 7674213    82 GLKCANISLNRKMLSEIAIHNPEGFAEIANQAK 114
gi 6094027    82 GLLQAGIALNRKVLSNMAIEDPGAFQTVIDASK 114
gi 669215574 923 GLKKASVEIDRKILADIAVFDKVAFTALVEKAK 955
gi 491782491  82 GLKKASVEIDRKILADIAVFDKVAFAALVEKAK 114
gi 2500291    81 LLKKHNIEINRKVLSELAIKEPSKFNLIVQKVK 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap