Conserved Protein Domain Family
pyrD_sub1_fam

?
TIGR01037: pyrD_sub1_fam 
dihydroorotate dehydrogenase (subfamily 1) family protein
This family includes subfamily 1 dihydroorotate dehydrogenases while excluding the closely related subfamily 2 (TIGR01036). This family also includes a number of uncharacterized proteins and a domain of dihydropyrimidine dehydrogenase. The uncharacterized proteins might all be dihydroorotate dehydrogenase.
Statistics
?
PSSM-Id: 130109
View PSSM: TIGR01037
Aligned: 6 rows
Threshold Bit Score: 484.239
Threshold Setting Gi: 3914509
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914513   3 LSVELFGIRFKNPVWVASGTFGYGVEAAEIYDISKLGAVVTKGLSLKERLGNETPRIVETPCGMLNSIGLQNPGVEKFLK 82
gi 131720    2 LEVKLPGLDLKNPIIPASGCFGFGKEFSRFYDLSCLGAIMIKATTKEPRFGNPTPRVAETGAGMLNAIGLQNPGLDSVLH 81
gi 3914506   5 LETSICNIELRNPTILAAGVMGSMASSLNRIYRGGAGAVVTKSFSLRPNPGYRNPTTVEVTGGVINAIGLSNPGVEAFRE 84
gi 2500041   6 LKTNICGIEFKNPVFLASGIMGETGSALKRIAKGGAGAVTTKSIGLNPNPGHKNPTIVEVYGGFLNAMGLPNPGVDEYLE 85
gi 9297037   6 LEVKLFGIRFENPLILASGVVDMTPELLRRAHNEGAGGVVTKSIGKEPRKGYDNPTIVELPYGLINAMGLPNPGWEAFLN 85
gi 3914509   4 LETEIGGLRMKNPLMLASGIMGSKVHSLNLIARD-AGAVVTKSVGVEEREGYRNPTVVNWKCGLINAVGLASPAAKDFAE 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914513  83 EIYPKIKDVDTH---FIANVFGETEEEYVEVCMALEDADK-IVAYELNVSCPNVKK-GGILFGHDPVILGNLVDRIKAKI 157
gi 131720   82 HELPWLEQFDTP---IIANVAGSQVDDYVEVAEHISKAPN-VHALELNISCPNVKT-GGIAFGTNPEMAADLTKAVKEVS 156
gi 3914506  85 ELKLVDEEVP-----LIASVYGASPEEFASAAASVE---EyADMIELNVSCPHAMAgCGASIGQDPELTFRVVSAVKDAV 156
gi 2500041  86 EIEKVRDELNRMdvrIIGSIYGKDEEEFAEVAKKME---RyVDIIELNISCPHAKG-YGATIGQNPDLSYDVCKAVKKAV 161
gi 9297037  86 EFIDERFDFP-----VIVSIFGGTPEEFAFLAEKLE---PvADAFELNLSCPHAKG-YGMEIGQDPKNVYEVVKAVKDVT 156
gi 3914509  83 ELKDYTNEAP-----LLISLYGHSVEEFSDLVDTFDSALPyLHGYELNLSCPHVKG-AGLDIGMDLELSAAIVEELKGKT 156
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914513 158 KKPLLVKLSPNVTDVTEFAKVCIENGADGLVLINTLM-GMKINIWKRKPDLATKTGGLSGPAILPIAVRMIYQVYEKFGd 236
gi 131720  157 DVPVYVKLSPNVANITEIALAIEEAGADGLTMINTLI-GMRLDLKTGKPILANKTGGLSGPAVKPVAIRMVYEVSQMVN- 234
gi 3914506 157 DVPISTKLTPNVTDIVEIAGSAEEAGSDALTLINSLGpGMKIDIKTARPILSNAFGGMSGPAIKPVAVRCVYDVYRSVD- 235
gi 2500041 162 KIPVFAKLTPNVTDIIEIAQAVVDAGVDGLVAINTVR-GMAIDIRAKKPILANKFGGLSGKAIKSIGIKVVWDLYENFD- 239
gi 9297037 157 DKPVIAKLTPNVNDITKLGLAAERGGADGVSAINTVK-AIAIDIYAKRPILSNKVGGYSGPGIKPIALRAVYDLAKVLD- 234
gi 3914509 157 KNPVFAKLS-AMHDYLKLAKVLEDAGVDGITISNTLR-GMKIDIMSGKPVLSNLSGGVSGPAIKPIALKCVYDLYKEIE- 233
                      250       260       270       280       290       300
               ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 3914513 237 rIPIIGVGGITTWEDAMEHVMAGASAVQVGTANFYEP-LAPLKVIEGIENFMKSQNIKDFKELIGIAH 303
gi 131720  235 -IPIIGMGGVQTAEDALEFLLAGASAVAVGTANFVNP-FACPEIIEQLPSVLLQYGYQSIEECIGRSW 300
gi 3914506 236 -IPIMGVGGVRDFQDAVEFLFAGARAVQVGTAIMYDGpEVFMKICRGLEAFMMAEGFSSVDEMVGLAH 302
gi 2500041 240 -VPIIGVGGIMSGEDAIEYMMAGASAVQIGSGVYYRGyDIFKKVCDEIISFLKEENLT-LEEIVGMAH 305
gi 9297037 235 -IPVIGIGGITSWRDAVEFLLAGASALQIGTAVYLRGfKVFKEISNGIIEYLKEEGFSSIRDIIGLAL 301
gi 3914509 234 -VPIVGCGGITSFEDVLEFIMAGARAVQIGSAVYYSR-RIFYSLKESLIAFTRARDCT-ISDLIGIAH 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap