1VDZ


Conserved Protein Domain Family
ATP_syn_A_arch

?
TIGR01043: ATP_syn_A_arch 
Click on image for an interactive view with Cn3D
ATP synthase archaeal, A subunit
Archaeal ATP synthase shares extensive sequence similarity with eukaryotic and prokaryotic V-type (H+)-ATPases. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130115
View PSSM: TIGR01043
Aligned: 13 rows
Threshold Bit Score: 1088.22
Threshold Setting Gi: 114516
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VDZ_A         4 KGRIIRVTGPLVVADGMKgAKMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGVRPGEPVVGTGASLSVELGPGLLTS 83
gi 1199638     4 KGEIYRVAGPVVTAIGLD-AKMYDLCKVGNEGLMGEVIQIVGDKTIIQVYEETGGVRPGEPCVTTGMSLAVELGPGLLSS 82
gi 2493099    12 DGVIASVSGPVVTARGLD-ARMNDVVYVGDEGLMGEVIEIEGDLTTIQVYEETSGVGPGEPVESTGEPLTVDLGPGMMDA 90
gi 114516     10 TGEIESVSGPVVTATGLD-AQMNDVVYVGDEGLMGEVIEIEGDVTTIQVYEETSGIGPGQPVDNTGEPLTVDLGPGMLDS 88
gi 12585404    9 VGEIYRISGPLVVAEGLK-ARMYDLCKVGEEGLMGEVVGLVGQKVLIQVYEDTEGVKPGDKVENTGMPLSVELGPGLIRN 87
gi 12585397    4 EGRIIKIAGPVIIAEGMRgSQMYEMVKVGEDKLIGEIIELEGDTATIQVYEETAGIKPGETVERTGGPLSVELGPGILGS 83
gi 2104726     1 MGRIIRVTGPLVVADGMKgSKMYEVVRVGEMGLIGEIIRLEGDKAVIQVYEETAGIRPGEPVEGTGSSLSVELGPGLLTS 80
gi 2605627     1 MGRIIRVTGPLVVADGMKgAKMYEVVRVGEMGLIGEIIRLEGDKAVIQVYEETAGIRPGEPVEGTGSSLSVELGPGLLTS 80
gi 6015910     3 NGRIVRINGPLVVADNMRnAQMYEVVEVGEPRLIGEITRIEGDRAFIQVYEDTSGIKPNEPVYRTGAPLSIELGPGLIGK 82
gi 114528      4 EGRVVRVNGPLVIADGMReAQMFEVVYVSDLKLVGEITRIEGDRAFIQVYESTDGVKPGDKVYRSGAPLSVELGPGLIGK 83
gi 12585563    4 VGKIIKIAGPVVVAEGMKgAQMYEVVKVGEEKLTGEIIQLHDDKAVIQVYEETSGIKPGEPVVGTGAPLSVELGPGMLRA 83
gi 114520      4 KGEIYRVSGPVVTAIGLQ-AKMYDLVKVGNEGLMGEVIQILGPKTIIQVYEETAGIKPGEPCVSTGSSLSVELGPGLLSS 82
gi 499163878   4 KGSIVRISGPLVVAEGMSgAQMYEMVYVGEDRLIGEITRIRGDRAFIQVYESTSGLKPGEPVVGTGAPLSVELGPGLLGT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VDZ_A        84 IYDGIQRPLEVIREKTG-D-------FIARGVTAPALPRDKKWHFIPK-AKVGDKVVGGDIIGEVPETSIIVHKIMVPPG 154
gi 1199638    83 IYDGLQRPLHVLLERTG-G-------FIGRGVTADGLDHKKLWEFKPV-VKKGDGVIGGDVIGVVQETVNIEHKIMLPPD 153
gi 2493099    91 IYDGVQRPLDVLESKMDsA-------FLDRGVDAPGIDLDEKWEFEPT-VSEGDEVAPGDVVGTVPETVTIEHKVMVPPD 162
gi 114516     89 IYDGVQRPLDVLEDEMG-A-------FLDRGVDAPGIDLDTDWEFEPT-VEAGDEVAAGDVVGTVDETVSIEHKVLVPPR 159
gi 12585404   88 IYDGVQRPLPVLKEVSG-D-------FIGRGIEAPGLDRKAKWEFKPL-VKKGEKVKPGEIIGTVQETEVVEQKILVPPN 158
gi 12585397   84 IFDGIQRPLENIKALTG-D-------YIERGVDVPSLPKDKKWTFKPT-AREGQMVKGGDIIGEVEETSSITHRIMIPPN 154
gi 2104726    81 MYDGIQRPLEKLRELSG-D-------FIARGLTAPALPRDKKWHFTPT-VKVGDKVTGGDILGVVPETSIIEHKILVPPW 151
gi 2605627    81 MYDGIQRPLDVLRQLSG-D-------FIARGLTAPALPRDKKWHFTPK-VKVGDKVVGGDILGVVPETSIIEHKILVPPW 151
gi 6015910    83 IFDGLQRPLDSIKELTKsP-------FIARGIKVPSIDRKTKWHFVPK-VKKGDKVEGGSIIGIVNETPLVEHRILVPPY 154
gi 114528     84 IYDGLQRPLDSIAKVSNsP-------FVARGVSIPALDRQTKWHFVPK-VKSGDKVGPGDIIGVVQETDLIEHRILIPPN 155
gi 12585563   84 MYDGIQRPLTAIEEKTG-Si------FIPRGVDVPALPRDIKWEFKPV-VNEGDYVEEGDIIGTVDETPSIVHKILVPIG 155
gi 114520     83 IYDGVQRPLHVLLEKMG-S-------FIQRGVSADGLDHKKLWDFKPI-VKKGDSVKGGDVIGVVQETVNIEHKIMVPPD 153
gi 499163878  84 IYDGVQRPLPIIAEKVA-EvdprrrmFVERGIQAPPLPRDRKFHFKPEpLKEGDKVEGGDALGRVPETSLIEHVVMVPPG 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VDZ_A       155 IEG-EIVEIAeEGDYTIEEVIAKVKtpSGe-Ik-ELKMYQRWPVRVKRPYKEKLPPEVPLITGQRVIDTFFPQAKGGTAA 231
gi 1199638   154 ISG-TVSDIR-SGSFTVVDTICTLT--EG--P--ELQMMQRWPVRKPRPVKRKLTPEKPLVTGQRILDGLFPVAKGGTAA 225
gi 2493099   163 FGGgEVVAVE-EGEFSVTEAVVELD--SG--E--EITMHQEWPVRQARPAAEKKTPREPLVSGQRILDGLFPIAKGGTAA 235
gi 114516    160 SDGgEVVAVE-SGTFTVDDTVVELD--TG--E--EIQMHQEWPVRRQRPTVDKQTPTEPLVSGQRILDGLFPIAKGGTAA 232
gi 12585404  159 VKEgVIAEIY-EGSFTVEDTIAVLE--DG--T--ELKLYHKWPVRIPRPYVEKLPPVVPLITGQRILDTFFPVAKGGTAA 231
gi 12585397  155 VEG-KLTMIApQGEYTVLDDIAEVEteSGt-E--KIQMLQKWPVRKGRPYKKKLDPDVPLVTGQRAQDTFFSVAKGGTAA 230
gi 2104726   152 VEG-EIVEIAeEGDYTVEEVIAKVKkpDGsiE--ELKMYHKWPVRVKRPYKNKLPPEVPLITGQRTIDTFFSIAKGGTAA 228
gi 2605627   152 VEG-EIVEIAeEGDYTVEEVIVKVKkpDGtiE--ELKMYHRWPVRVKRPYKQKLPPEVPLITGQRTIDTFFSQAKGGTAA 228
gi 6015910   155 VHG-TLKEVVaEGDYTVEDPIAIVDm-NGdeV--PVKLMQKWPVRIPRPFKEKLEPTEPLLTGTRVLDTIFPIAKGGTAA 230
gi 114528    156 VHG-TLKELArEGDYTVEDVVAVVDm-NGdeI--PVKMYQKWPVRIPRPYKEKLEPVEPLLTGIRVLDTVFPIAKGGTAA 231
gi 12585563  156 VKG-KIVEIK-EGKFTVEETVAVVEt-ENg-ErkEITMMQKWPVRKPRPYKEKLPPEIPLITGQRVEDTFFTLAKGGTAA 231
gi 114520    154 ISG-TISDIK-SGNFTVVDTICTLT--DG--T--ELQMMQRWPVRRPRPVKAKLTPTRPLVTGMRILDGLFPVAKGGTAA 225
gi 499163878 163 IRG-RLKWLAsEGDYSVEDTIAVVEr-DGrdV--EIRMHQRWPVRIPRPFKEKLEPQLPLITGVRIIDTFFPMAKGGTGA 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VDZ_A       232 IPGPFGSGKTVTQHQLAKWSDAQVVIYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMPVAAREASIYT 311
gi 1199638   226 IPGPFGSGKTVTQQQLSKWSDTEIVVYIGCGERGNEMADVLWEFPELEEPQTGRPLMERTILVANTSNMPVAAREASVYT 305
gi 2493099   236 IPGPFGSGKTVTQHQLAKWADADIVVYVGCGERGNEMTEVIEDFPELDDPKTGNPLMARTCLIANTSNMPVAARESCIYT 315
gi 114516    233 IPGPFGSGKTVTQQSLAKFADADIVVYIGCGERGNEMTEVIEDFPELPDPQTGNPLMARTTLIANTSNMPVAGRESCIYT 312
gi 12585404  232 IPGPFGSGKTVTQHQLAKWSDAQIVVYIGCGERGNEMTEVLEEFPELEDPRTGKPLMERTVLVANTSNMPVAAREASVYT 311
gi 12585397  231 IPGPFGSGKTVTQQQLAKWADADIIVYVGCGERGNEMTEVLKEFPELEDPKTGNPLMDRTVLIANTSNMPVAAREACVYT 310
gi 2104726   229 IPGPFGSGKTVTQHQLAKWSDAQVVVYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMPVAAREASIYT 308
gi 2605627   229 IPGPFGSGKTVTQHQLAKWSDAQVVVYIGCGERGNEMTDVLEEFPKLKDPKTGKPLMERTVLIANTSNMPVAAREASIYT 308
gi 6015910   231 IPGPFGSGKTVTLQSLAKWSAAKIVIYVGCGERGNEMTDELRQFPSLKDPWTGRPLLERTILVANTSNMPVAAREASIYV 310
gi 114528    232 IPGPFGSGKTVTLQSLAKWSAAKVVIYVGCGERGNEMTDELRSFPKLKDPWTGKPLLLRTILVANTSNMPVAARESSIYV 311
gi 12585563  232 IPGPFGSGKTVTQHQLAKWSDADVVVYIGCGERGNEMTEVIEEFPHLEDIRTGNKLMDRTVLIANTSNMPVAAREASVYT 311
gi 114520    226 IPGPFGSGKTVTQQSLAKWSDTEIVVYIGCGERGNEMADVLSEFPELEDPQTGRPLMERTVLIANTSNMPVAAREASVYT 305
gi 499163878 239 VPGGFGTGKTVTLHSLAQWSEARVVIYIGCGERGNEMTEVLERFPQYKDPWTGKPLMDRTVLIANTSNMPVAAREASIYV 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VDZ_A       312 GITIAEYFRDMGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLASKLAEFYERAGRVVTLGSDyrVGSVSVIGA 391
gi 1199638   306 GMTLAEYFRDMGYDVSLMADSTSRWPEAMREISSRLEEMPGEEGYPAYLSARLAEFYERAGVAETLCGE--KGSITAIGA 383
gi 2493099   316 GITIAEYYRDMGYDVALMADSTSRWAEAMREISSRLEEMPGEEGYPAYLAARLSEFYERAGYFTTVNGE--EGSVSVIGA 393
gi 114516    313 GITIAEYYRDMGYDVALMADSTSRWAEAMREISSRLEEMPGEEGYPAYLAARLSEFYERAGYFENFNGT--EGSISVIGA 390
gi 12585404  312 GITIAEYFRDMGYDVAIQADSTSRWAEAMREISGRLEEMPGEEGYPAYLASRLAEFYERAGRVKTLAGN--IGSVTVVGA 389
gi 12585397  311 GITIAEYFRDMGYDVALMADSTSRWAEAMREISGRLEEMPGEEGYPAYLASRLAQFYERAGRVTTIGSEdkIASVSVVGA 390
gi 2104726   309 GITIAEYFRDQGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLASKIAEFYERAGRVVTLGSEprVGSVSVIGA 388
gi 2605627   309 GITIAEYFRDQGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLASKIAEFYERAGRVITLGSDerVGSVSVIGA 388
gi 6015910   311 GITMAEYFRDQGYDTLLVADSTSRWAEALRDLGGRMEEMPAEEGFPSYLPSRLAEYYERAGRVKTIGNPerFGSVTVASA 390
gi 114528    312 GVTMAEYFRDQGYDVLLVADSTSRWAEALRDLGGRMEEMPAEEGFPSYLPSRLAEYYERAGRVIALGNPerYGSVTIASA 391
gi 12585563  312 GITIAEYFRDMGYGVLLTADSTSRWAEAMREISGRLEEMPGEEGYPAYLASRLAQFYERAGRVITLGKDnrQGFVCIVGA 391
gi 114520    306 GITIAEYYRDMGLDVSLMADSTSRWAEAMREISSRLEEMPGEEGYPAYLSARLAEFYERAGVAESLCGE--TGSITVIGA 383
gi 499163878 319 GITIAEYYRDMGYDVLLVADSTSRWAEALREIAGRLEEMPAEEGYPSYLASRLAEFYERAGRVKALGSPerSGSVTVVGA 398
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VDZ_A       392 VSPPGGDFSEPVVQNTLRVVKVFWALDADLARRRHFPAINWLTSYSLYVDAVKDWWHKNIDPEWKAMRDKAMALLQKESE 471
gi 1199638   384 VSPPGGDFSEPVTQNTLRIVKVFWALDAKLSQKRHFPAINWLNSYSLYKEDLNDWFTENVAPDYVPMRERAMDMLQTESE 463
gi 2493099   394 VSPPGGDFSEPVTQNTLRIVKTFWALDADLAERRHFPAINWNESYSLYQEQLDPWFVENVEDDWAEERQWAVDVLDEENE 473
gi 114516    391 VSPPGGDFSEPVTQNTLRIVKTFWALDSDLAERRHFPAINWDESYSLYKDQLDPWFTDNVVDDWAEQRQSAVDILDEESE 470
gi 12585404  390 VSPPGGDFSEPVTQNTLRIVKVFWALDAKLAARRHFPAINWLQSYSLYVDTLKDWFAENVSEEWNELRRWAMEVLQEEAN 469
gi 12585397  391 VSPPGGDLSEPVTQNTLRICKVFWALDASLADKRHFPSIDWLQSYSLYIDSVQEWWASNVDPEWRKFRDEAMALLQKEAE 470
gi 2104726   389 VSPPGGDFSEPVVQNTLRVVKVFWALDADLARRRHFPAINWLRSYSLYLDSIQDWWHKNVDPEWRKMRDTAMALLQKEAE 468
gi 2605627   389 VSPPGGDFSEPVVQNTLRVVKVFWALDADLARRRHFPAINWLRSYSLYVDAIQDWWHKNVDPEWRKMRDTAMALLQKEAE 468
gi 6015910   391 VSPPGGDFTEPVTSQTLRFVKVFWPLDVSLAQARHYPAINWLQGFSAYVDLVANWWNTNVDPKWREMRDMMVRTLIREDE 470
gi 114528    392 VSPPGGDFTEPVTSNTLRFVRVFWPLDVSLAQARHYPAINWIQGFSAYVDLVAQWWHKNVDPNWKEMRDTMMKVLIREDE 471
gi 12585563  392 VSPPGGDFSEPVTSNTLRIVKVFWALDANLARRRHFPAINWLQSYSLYIDDVTEWWNTNTGPDWRQLRDEAMSLLQKEAE 471
gi 114520    384 VSPPGGDFSEPVTQNTLRIVKVFWALDAKLSQRRHFPAINWLNSYSLYKDSLNDWFADNVAPDYVPLRERAMEMLQTESE 463
gi 499163878 399 VSPPGGDFSEPVTSHTTRFIRVFWALDTKLAYSRHYPAINWLMSYSAYVDLVTQWWHENVDKRWREYRDEAMDILLRESE 478
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VDZ_A       472 LQEIVRIVGPDALPERERAILLVARMLREDYLQQDAFDEVDTYCPPEKQVTMMRVLLNFYDKTMEAINRGVPLEEIAKLP 551
gi 1199638   464 LQEIVQLVGSDALPEEQQLLLEITRMIREIFLQQNAFHPIDTYSPFEKQYKIMKAIMKWGDAAMDALKSGVPSSEILKIE 543
gi 2493099   474 LQEIVQLVGKDALPEDQQLTLEIARYLREAYLQQNAFHPTDTYCSPEKTYGILTAIHAFNDEAFKALEAGVPVEEIQAIE 553
gi 114516    471 LEEIVQLVGKDALPEDQQLTLEVARYIREAWLQQNALHDVDRYCPPEKTYAILSGIKTLHEESFEALDAGVPVEEITSID 550
gi 12585404  470 LQEIVQLVGSDALPESQRVLLEVARIIREVYLIQYAYHPVDTYCSVQKQYDMLKAIKQINDWFYQALEAGKTIDEIAGVE 549
gi 12585397  471 LQEIVQLVGPDALPDRERITLETTRMIREDFLQQNAYHEVDTYCSPSKQFEMLRTIIMFHRNATAALEKGAPAADIISLP 550
gi 2104726   469 LQEIVRIVGPDALPDREKAILIVTRMLREDYLQQDAFDEVDTYCPPKKQVTMMRVILNFYERTMEAVDRGVPVDEIAKLP 548
gi 2605627   469 LQEIVRIVGPDALPDREKAILIVTRMLREDYLQQDAFDEVDTYCPPKKQVTMMRVILNFYEKTMQAVDRGVPVDEIAKLP 548
gi 6015910   471 LRQIVRLVGPESLAEKDKLILETARLIKEAFLKQNAYDDIDAFSSPQKQARIMRLIYLFNTYASKLVERGIPTKKIVDSM 550
gi 114528    472 LRQIVRLVGPEELAEKDKLVLEAAKLIKDAFLKENAYDDIDAFSSPQKQVRIMRLIYIFYNQSQDLISKGVPLKKILDKV 551
gi 12585563  472 LQEIVQLVGPDALPDRERVILEVARMLREDFLQQDAFDEVDTYCPPMKQYLMLKIIMTFYQEALKAVERGVEPAKILGVS 551
gi 114520    464 LQEIVQLVGSDALPDDQQLLLEITRMLREIFLQQNAFHPVDAYSPFDQQYKILKAIMKWGDAAMDALKSGVPVTEIIKLE 543
gi 499163878 479 LQEIVRLVGTEGLDEKDKMVLETARLIKDGFLKQNAFDPIDAFATPQKQFRLLKMIMDIHRKSLELIEKGVTTQQILQAL 558
                        570       580       590
                 ....*....|....*....|....*....|....*
1VDZ_A       552 --VREEIGRMKFERDvskIRSLIDKTNEQFEELFK 584
gi 1199638   544 --SKDSLPKVKYEEN---FEDSLNAVLAKMDKEFA 573
gi 2493099   554 --AAPRLNRIGVQED---WEAYIEDLKAEITEQLR 583
gi 114516    551 --AAPRLNRLGTTPDd-eHEAEVAEIKQQITEQLR 582
gi 12585404  550 --GLEEFARAKFEED---YKPAMEAALEKIRKNLL 579
gi 12585397  551 --VKEDIGRMKYIPEeefP-ARIKEIQERIVKECS 582
gi 2104726   549 --VREKIGRMKFEPDiekIRALIDETNEQFEELFK 581
gi 2605627   549 --VREKIGRMKFEPDvekVRALIDETNQQFEELFK 581
gi 6015910   551 gqLLPEIIRSKAAIKn-dELNRYDELERKLITVFE 584
gi 114528    552 gpIEPEIIRIKYTIKn-dELNKIDEIENKLKATFD 585
gi 12585563  552 --VKQDIARMKYIPHdefINVKSKEIMEKIKNELG 584
gi 114520    544 --SKNVLAKVKYEEK---FDESMNAVLAQMDKEFA 573
gi 499163878 559 grLYIDIVKAKFTIPn-dQLEKIDEIRDRALKALD 592
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap