3J3V,1P85


Conserved Protein Domain Family
rplV_bact

?
TIGR01044: rplV_bact 
Click on image for an interactive view with Cn3D
ribosomal protein L22, bacterial type
This model decribes bacterial and chloroplast ribosomal protein L22. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130116
View PSSM: TIGR01044
Aligned: 10 rows
Threshold Bit Score: 132.254
Threshold Setting Gi: 2500298
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3J3V_S         5 AVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKR 84
gi 3122713    11 AKARFVRVSPRKARRVIDLVRGRSVADALDILRWAPQAASEPVARVIASAAANAQNNNGLDPETLVVATVYAGEGPTAKR 90
gi 132781      5 AKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKR 84
gi 1172992     5 AVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKR 84
gi 642166      5 AVARTVRIAPRKARLVMDLIRGKQVGEAVSNLNLTPISASPIIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKR 84
gi 132779      5 AVARTVRIAPRKARLVIDLIRGKEVGERFAILRHTPKAASPIIEKVLKSAVANAEHNYDMDVNNLVISQAYVDEGPTLKR 84
gi 2500298     4 ALLRFVRLSPTKARLIARQIQGMNAELAIASLEFTPNKAARVLSKVVASAVANG----SLDAKSALIVSCRVDAGPVLRR 79
gi 489845584   5 AQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEHNNGADIDELKVVTIFVDKGPSLKR 84
gi 6174953    15 AKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKR 94
1P85_Q         5 AKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKR 84
                         90       100
                 ....*....|....*....|...
3J3V_S        85 FRPRAMGRASQINKRTSHITIVV 107
gi 3122713    91 IRPRAQGRAFRIRRRTSHITVVV 113
gi 132781     85 IMPRAKGRADRILKRTSHITVVV 107
gi 1172992    85 FRPRAMGRASQINKRTSHITIVV 107
gi 642166     85 LRPRAMGRASQINKRTSHITVVV 107
gi 132779     85 FRPRAMGRASAINKRTSHITIVV 107
gi 2500298    80 SIPRAKGRATAIRKPTSHVFVEV 102
gi 489845584  85 FQARAKGRGNRIEKQTCHINVTV 107
gi 6174953    95 IRPRAQGRAFRIRRRTSHITVVV 117
1P85_Q        85 IMPRAKGRADRILKRTSHITVVV 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap