1P6G


Conserved Protein Domain Family
rpsJ_bact

?
TIGR01049: rpsJ_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S10, bacterial/organelle
This model describes bacterial 30S ribosomal protein S10. In species that have a transcription antitermination complex, or N utilization substance, with NusA, NusB, NusG, and NusE, this ribosomal protein is responsible for NusE activity. Included in the family are one member each from Saccharomyces cerevisiae and Schizosaccharomyces pombe. These proteins lack an N-terminal mitochondrial transit peptide but contain additional sequence C-terminal to the ribosomal S10 protein region. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130121
View PSSM: TIGR01049
Aligned: 22 rows
Threshold Bit Score: 115.81
Threshold Setting Gi: 1173310
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1P6G_J       4 QRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKT 83
gi 6685921   4 EKIRIKLRAYDHRLLDQSVKQIIETVKRTGGVVKGPIPLPTRKRKWCVLRSPHKFDQSREHFEIREFSRILDIIRFTPQT 83
gi 2500432   2 EKIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQFEIRVYSRLIDIISATPET 81
gi 6094145   4 ERIRVKLCGFDVELVDQSSRAIVHAVQKAGAEVLGPIPLPTRMHKFTVLRSPHVNKKSREQFEMRTHKRLIDIIEPSQEV 83
gi 2500431   5 DKIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQFEMRTHKRLIDILEPTSAL 84
gi 1350918   3 NKIKIRLKSFDHRSLDQATKEIVSAVKRTFATINGPIPLPRKIERFTVNRSPHVHKKSREQFEIRKHKRLLVIDDPNPAV 82
gi 1350916   8 PELKIKLESYDSTLLDLTIKKIVEVVKGVNIKIKGPLPLPTKKEVITIIRSPHVDKASREQFEKNTHKRLMILVDVNQGG 87
gi 6899200   3 QELRIRLESYDHRLLDDTVKTIVNISNSTGSKLRGPIPLPTKKEIFTILRSPHVNKSSREQFERRTHKRLIILENPQPKT 82
gi 976131   41 lvadIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEV 120
gi 3116129  63 lcasLKIKSFETPKLDTFTDFICRTAYYMKIPIKGPRPLPNKVESWTLLRSPFIHKSSQENFERITHSRLIQLYSVNPVT 142
                       90       100
               ....*....|....*....|...
1P6G_J      84 VDA----LMRLDLAAGVDVQISL 102
gi 6685921  84 IEA----LMEISLPAGVDVEVKM 102
gi 2500432  82 VDS----LMKLDLAPEVDVEVTS 100
gi 6094145  84 MNA----LMGLELSAGVDVRIKQ 102
gi 2500431  85 MDS----LMKLELPAGVEVDIKQ 103
gi 1350918  83 VDA----LSKVDLAAGVDVVIEL 101
gi 1350916  88 IDS----LKKIKIPVGVTLRFSK 106
gi 6899200  83 MEA----LKRLSVPFGVEVTFKI 101
gi 976131  121 LQM----LIA---------YITK 130
gi 3116129 143 LETffsyLRKCNM---WDLKLQA 162
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap