Conserved Protein Domain Family
LSD1

?
TIGR01053: LSD1 
zinc finger domain, LSD1 subclass
This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Statistics
?
PSSM-Id: 130125
View PSSM: TIGR01053
Aligned: 5 rows
Threshold Bit Score: 48.9931
Threshold Setting Gi: 5262161
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|.
gi 3080405  60 QMVCGSCRRLLSYLRGSKHVKCSSCQTVNLV 90
gi 5262161  50 HIICGGCRTMLMYTRGASSVRCSCCQTTNLV 80
gi 5262161   9 QLVCHGCRNLLMYPRGASNVRCALCNTINMV 39
gi 3258570  15 LVNCSGCRTPLQLPSGARSIRCALCQAVTHI 45
gi 4455254   4 LVDCSSCRTPLHLPPGATRIRCAICHAFTLI 34
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap