Conserved Protein Domain Family
parE_Gneg

?
TIGR01055: parE_Gneg 
DNA topoisomerase IV, B subunit, proteobacterial
Operationally, topoisomerase IV is a type II topoisomerase required for the decatenation of chromosome segregation. Not every bacterium has both a topo II and a topo IV. The topo IV families of the Gram-positive bacteria and the Gram-negative bacteria appear not to represent a single clade among the type II topoisomerases, and are represented by separate models for this reason. This protein is active as an alpha(2)beta(2) heterotetramer. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130127
View PSSM: TIGR01055
Aligned: 3 rows
Threshold Bit Score: 1079.94
Threshold Setting Gi: 15604098
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018     2 TTNYSAQEITVLKDLEPVQIRPGMYT---DTTRPNHLAQEVIDNSVDEALAGFATKIEVILHPDQSIEVTDNGRGMPVDI 78
gi 464346      2 TQTYNADAIEVLTGLEPVRRRPGMYT---DTTRPNHLGQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDDGRGMPVDI 78
gi 490736238  17 YTNYSAKDIEVLDGLEPVRKRPGMYIggtDSNAMHHLVSEVLDNAMDEAVAGFASIIMIKMHQDHSITIFDNGRGIPIDN 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018    79 HPTE-GVSGVEVILTKLHAGGKFSNKNYEFAGGLHGVGISVVNALSERVDIQVKRNGEIYKIAFENGSKVEELEIIGTCG 157
gi 464346     79 HPEE-GVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCG 157
gi 490736238  97 HPKFpDKSALEVILTTLHSGSKFSNNVYHTSGGLHGVGISVVNALSKHFKIKVYKQGKLYSQSYSKGAKLTDLISAEAS- 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018   158 RRTTGTIVHFKPNPKYFDS-AKFSVSRLRHLLRAKAVLCSGLEIKFIDKVNN-----TQDIWLYEDGLSDYLIEAVNGFE 231
gi 464346    158 KRNTGTSVHFWPDETFFDS-PRFSVSRLTHVLKAKAVLCPGVEITFKDEINN-----TEQRWCYQDGLNDYLAEAVNGLP 231
gi 490736238 176 KRLRGTSINFTPDPEIFSEkLHFNPKKIYEIARSKAYLYRGVSIEWECEVEVpsdipKKALINFPNGLKDYLSSKISLDN 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018   232 TLPKKPFVGEFKG--ANEAVSWALLWLPEGGELIGESYVNLIPTIQGGTHVNGLRQGLLDAIREFCEFRNLLPRGVKLTA 309
gi 464346    232 TLPEKPFIGNFAG--DTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSA 309
gi 490736238 256 LVIPEIFSGNIEStvDDIKLEWAICWQNNDTSAFMQSYCNTVPTPQGGTHEQGLKSAILRGLKAYSEMIGNK-KAANLTI 334
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018   310 DDIWDRCSYILSLKMQDAQFAGQTKERLSSRQSAVFVSGVLKDAFSLWLNQNVQDAEKLAEIAISSAQRR--LRAAKKVV 387
gi 464346    310 EDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRR--MRAAKKVV 387
gi 490736238 335 EDILETASIVLSIFIVEPSFQGQTKEKLVSNGVSKLVENIIKDHFDHFLSSDKVLATHLLEHVIAIAEFRrnKKNERNIS 414
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018   388 RKKLVSGPALPGKLADCGSQDLEKTELFLVEGDSAGGSAKQARDREYQAILPLRGKILNTWEVSPDQVLGSTEIHDIAVA 467
gi 464346    388 RKKLTSGPALPGKLADCTAQDLNRTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVA 467
gi 490736238 415 RKSVTQKLRLPGKLADCTRTSAEGTELFIVEGDSAGGSAKQARNRETQAVLPLWGKVLNVASSTLEKIINNQAIQDLEIA 494
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018   468 LGIDPDSND-LSQLRYGKVCILADADSDGLHIATLLCALFLRHFPKLVQDGHVYVAMPPLYRIDLNKEVFYALDENEKEA 546
gi 464346    468 IGIDPDSDD-LSQLRYGKICILADADSDGLHIATLLCALFVKHFRALVKHGHVYVALPPLYRIDLGKEVYYALTEEEKEG 546
gi 490736238 495 LACGSLKNYkKENLRYEKIIIMTDADVDGAHIASLLMTFFFLRMPKLVEEGHLYLAKPPLYRLTQSNKIYYACDEEEKIK 574
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1172018   547 ILDRLKNK-KGKPNVQRFKGLGEMNPSQLRETTMDPNTRRLVQLTYDLGEDQGSDtlELMDMLLAKKRSEDRKNWLQA-- 623
gi 464346    547 VLEQLKRK-KGKPNVQRFKGLGEMNPMQLRETTLDPNTRRLVQLTIDDEDDQRTD--AMMDMLLAKKRSEDRRNWLQE-- 621
gi 490736238 575 LTYKLSKAsKAKIEVGRFKGLGEMMPAQLKETTMHPEKRSLLKVTLEDVQN--VD--KIVDDLMGKK-PEKRFQFIYEqa 649

                 ....*..
gi 1172018   624 --KGDQV 628
gi 464346    622 --KGDMA 626
gi 490736238 650 lvKMDQI 656
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap