Conserved Protein Domain Family
parE_Gpos

?
TIGR01058: parE_Gpos 
DNA topoisomerase IV, B subunit, Gram-positive
Operationally, topoisomerase IV is a type II topoisomerase required for the decatenation step of chromosome segregation. Not every bacterium has both a topo II and a topo IV. The topo IV families of the Gram-positive bacteria and the Gram-negative bacteria appear not to represent a single clade among the type II topoisomerases, and are represented by separate models for this reason. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130130
View PSSM: TIGR01058
Aligned: 4 rows
Threshold Bit Score: 1106.85
Threshold Setting Gi: 1352716
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342   1 MSKKeininnYNDDAIQVLEGLDAVRKRPGMYIGSTDGAGLHHLVWEIVDNAVDEALSGFGDRIDVTINKDGSLTVQDHG 80
gi 3914289    1 MARKqq--fdYNEDAIQVLEGLEAVRKRPGMYIGSTDARGLHHLVYEIVDNSVDEVLAGHGDHIIVKIHKDNSISVQDRG 78
gi 6899460    1 MANK------YDGNAIKILEGLEAVRKRPGMYIGSTSSTGLHHLIWEIVDNSIDEVMNANAKNINVILHEDNSISVLDDG 74
gi 1352716    1 MKSN------YSATNIKILKGLDAVKKRPGMYIGSTDSKGLHHMLWEILANSVDEVLAGYATNITVTLDLNNTITVSDDG 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342  81 RGMPTGMHAMG-IPTVEVIFTILHAGGKFGQGGYKTSGGLHGVGSSVVNALSSWLEVEITRDGAVYKQRFENGGKPVTTL 159
gi 3914289   79 RGMPTGMHKLG-KPTPEVILTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLTVTIERDGFVYQQRFENGGKPVTSL 157
gi 6899460   75 RGIPVDINSQTkISTVETVLTVLHAGGKFDESAYKTAGGLHGVGSSVVNALSSWLICEVYRDQKIYQAKFINGGHINQSL 154
gi 1352716   75 RGIPYEIHQDSnISTIDTVFTFLHAGGKFDDQSYKLAGGLHGVGASVVNALSDHLEVTVKRNGQIYQSVYQAGGKIIQKA 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342 160 KKIGTApkSKTGTKVTFMPDATIFSTTDFKYNTISERLNESAFLLKNVTLSLTDKRTNEAIEFHYENGVQDFVSYLNEDK 239
gi 3914289  158 EKIGKT--KKTGTLTHFKPDPTMFSTTTYNFETLSERLRESAFLLKGLKIELIDERNDQREVFYYENGIEAFVAYLNEEK 235
gi 6899460  155 KVIGTT--KKTGTLIHFLPDPLIFKNLVFNPNIIKERLHESTFLIKDLKIIFEDKINKKKYEFINNQGLIDFIKFINEAK 232
gi 1352716  155 KKIGDT--TSHGTTVSFHADPKVFKKAQFDSNIIKSRLKELSFLFAKLKLTFTDQKTNKTTVFFSTSGLVQFLDEINNTV 232
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342 240 EILTPVLYFEGEDNGFQVEVALQYNDGFSDNILSFVNNVRTKDGGTHETGLKSAITKVMNDYARKTGLLKEKDKNLEGSD 319
gi 3914289  236 DVLSEVVSFEGEHHSIEVDFAFQFNDGYSENILSFVNNVRTKDGGTHESGAKTAMTRAFNEYARKVALLKEKDKNLEGTD 315
gi 6899460  233 KTFSDVIYFRSNINKIDVEIAFQYSDQNNEIMVSFANSVKTSEGGVHENAFKNALTSVVNNYARKHNLLKEKDKNLEGDD 312
gi 1352716  233 ETLGQKTLIKGEKDGIEVEVVFQFNQSDQETILSFANSIKTFEGGSHENGFCLAISDVINSYCRKYNLLKEKDKNFQLSE 312
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342 320 YREGLAAVLSILVPEEHLQFEGQTKDKLGSPLARPVVDGIVADKLTFFLMENGELASNLIRKAIKARDAREAARKARDES 399
gi 3914289  316 IREGLSAIISVRIPEELLQFEGQTKGKLGTSEARSAVDAIVSEQLAYFLEENRDTATLLVKKAIKASQAREAARKAREEA 395
gi 6899460  313 IREGLSSVISLRIPESLISYEGQTKNKLFTPEANEAVKKTIEDNFSFWLEENKTQALDLVNRAILARDAKLAAKRAREET 392
gi 1352716  313 IRQGLNAIIKVNLPEKNIAFEGQTKSKLFSKEVKNVVYELVQQHYFQFLERNNNDAKLIIDKLLNARKIKEQIKQQRELK 392
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342 400 RNGKKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVVNTAKAK-MADILKNEEINT 478
gi 3914289  396 RSGKKRKKSEATLSGKLTPAGSRNPAKNELYLVEGDSAGGSAKQGRDRRFQAVLPLRGKVINTEKAK-LADIFKNEEINT 474
gi 6899460  393 KKVKKIKEERG-MGGKLTPAQSKDPVLNELFLVEGDSAGGSAKLGRNKKYQAILPLRGKVLNVLKAR-LVDVLKNEEIAS 470
gi 1352716  393 KSLSSPQKEK-ILFGKLAPCQTKKTSEKELFIVEGDSAGGTAKMGRDRIFQAILPLRGKVLNVEKINnKKEAITNEEILT 471
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342 479 MIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKeeVAYA 558
gi 3914289  475 IIHAIGGGVGADFSIDDINYDKIIIMTDADTDGAHIQVLLLTFFYRYMKPLIEHGKVFIALPPLYKVSKGSGKKeiIEYA 554
gi 6899460  471 IFTCLGTGIGAEFDLKKLKYHKIIIMTDADTDGSHIQVLLLTLFYRFMRPLIENGNIYIALPPLYKLTNKNNKK--FFYA 548
gi 1352716  472 LIFCIGTGILTNFNIKDLKYGKIIIMTDADNDGAHIQILLLTFFYRYMQPLIELGHVYLALPPLYKLETKDRKT--VKYL 549
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19864342 559 WTDGELEELRKQFgKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVK 638
gi 3914289  555 WSDEEMGDVLKKVgKGYTIQRYKGLGEMNADQLWETTMNPESRTLVRVKIDDAARVERRVTTLMGDKVEPRRKWIEKNVA 634
gi 6899460  549 WDDVELDQLKKEQ-KNYEIQRYKGLGEMNADQLFETTMDPNNRLLLKININDILQAERQINTLMGNDVSIRKQWIDNNID 627
gi 1352716  550 WSDLELESVKLKL-NNFTLQRYKGLGEMNADQLWDTTMNPTTRKLVQVKLDDLINAEKQINIFMGEKSDLRKHWIEANIN 628

                ....*....
gi 19864342 639 FTLEETTVF 647
gi 3914289  635 FGLDEESNI 643
gi 6899460  628 FSVIDELQI 636
gi 1352716  629 FSVEN---- 633
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap