Conserved Protein Domain Family
mutS2

?
TIGR01069: mutS2 
MutS2 family protein
Function of MutS2 is unknown. It should not be considered a DNA mismatch repair protein. It is likely a DNA mismatch binding protein of unknown cellular function. [DNA metabolism, Other]
Statistics
?
PSSM-Id: 130141
View PSSM: TIGR01069
Aligned: 5 rows
Threshold Bit Score: 879.923
Threshold Setting Gi: 3914057
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084   1 MQQKVLSALEFHKVKEQVIGHAASSLGKEMLLELKPSASIDEIKKQLDEVDEASDIIRlr-gQAPFGGLVDIRGALRRAE 79
gi 3914083   9 IAEETLALLEWPRLCQHLSTFTQTPLGAIAARYLLPPSQWEESRELLAQTQAVESIENspesNWHFKGIADITEPLARVE 88
gi 3914080   1 MREKDLIKLEFDKVKEVLASYAHSPATKEKIQNLKPYTNKEKVKEEIELSKAFFDIAE----NVRLFEFEDIRELLKKAK 76
gi 3914072  35 snqkilktkeslekifsfvslirmlfesckgypnsfinslkypisllLKENSRVSIEN---------------------- 92
gi 3914057  37 lfktffakerdtiALENDLKQTFTYLNEVDAIGLPTPKSVKESDLIIIKLTKLGTLHL---------------D-----E 96
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084  80 IGSVLSPSE-FTEISGLLYAVKQMKhfitQMAEDGVDIPLIHQHAEQLITLSDLERDINSCIDDHGEVLDH-ASETLRGI 157
gi 3914083  89 RGGLVTGLE-LLAIAGTLAGVRRLR----RVIEERDDLEILQTLVAEVRTLPELEQAIHHCLGEDGKVAER-ASPKLGEI 162
gi 3914080  77 LQGAILGVEdILKILNVINLTKEIRr---VLSSHVQRLEPLRKVYKKLYTFSPLENLIIGSIDPRGFVKDE-ASEELLRV 152
gi 3914072  93 LRDIIVFLDeVLRINLFLHKNSDIK-------H--LNVQILSDLLFLNPELKNLLNELKEHIDVDALELKSgVVKEYDSI 163
gi 3914057  97 IFEIVKRLHyIVVLQNAFKTFTHLK----------------FHERLNAIVLPPFFNDLIALFDDEGKIKQG-ANATLDAL 159
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 158 RTQLRTLESRVRDRLESMLRSSsaSKMLSDTIVTIRNDRFVIPVKQEYRSSYGGIVHDTSSSGATLFIEPQAIVDMNNSL 237
gi 3914083 163 RQKLKAVREQIQQKLQKIIQRQ--SNALQEAVITQRGDRFVLPIKAGYKEQMPGIVHDSSASGNTLYVEPQAIVELGNKL 240
gi 3914080 153 RKSIRAVEEEIKKRLDNLINRPdsAKFLSDRIVTIRNGRYVIPVKTSHVKKIFGIVHGTSSSGYTTYVEPQFVIHLNNKL 232
gi 3914072 164 EFEIKNLNRRVENQIKKIISLN--AEYLTSNFVCYKSNKYTLALKSNFKGKIKGNIISISSSGETFYIEPNDIVNANNRL 241
gi 3914057 160 NESLNRLKKESVKIIHHYARSKelAPYLVDTQSHLKHGYECLLLKSGFSGAIKGVVLERSANG-YFYLLPESAQKIAQKI 238
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 238 QQAKVKEKQEIERILRVLTEKTAEYTEELFLDLQVLQTLDFIFAKARYAKAVKATKPIMNDTG---FIRLKKARHPLLPP 314
gi 3914083 241 RQARRQEQTEEERILRQLSDQVLEVLLDLEHLLAIATRLDLATARVRYSFWLGAHPPQWLTPGdekPITLRQLRHPLLHW 320
gi 3914080 233 TELKQKEEEEVRKVLQRITEYIGDYAKELLESFEACVEVDFQQCKYRFSKLVEGSFPDFGe-----WVELYEARHPVLVL 307
gi 3914072 242 NYLSLEKERIILKILRNLSAKVHSNIVLLDNLYNNFLYYDSLKARAIYGIKTKGVFPEISN-----VLNIFDAHHPLLKD 316
gi 3914057 239 AQIGNEIDCCIVEMCQTLSHSLQKHLLFLKFLFKEFDFLDSLQARLNFAKAYNLEFVMPSFTq--kKMILENFSHPILKE 316
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 315 DQ-------VVANDIELGRDFSTIVITGPNTGGKTVTLKTLGLLTLMAQSGLHIPADEG-SEAAVFEHVFADIGDEQSIE 386
gi 3914083 321 QAekeggpaVVPITLTIDSQIRVIAITGPNTGGKTVTLKTLGLVALMAKVGLYIPAKET-VEMPWFAQILADIGDEQSLQ 399
gi 3914080 308 VKe-----dVVPVGILLK-EKKGLILTGPNTGGKTVALKTLGLSVLMFQSAIPVPASPN-SKLPLFEKVFTDIGDEQSIE 380
gi 3914072 317 SK-------AITFTPAEN---RVVIITGPNAGGKTVTLKTIGLLSAMFQFGIPIVVGES-STFKIFDNIFIDIGDEQSIS 385
gi 3914057 317 PK-----------PLNLKFEKSMLAVTGVNAGGKTMLLKSLLSAAFLSKHLIPMKINAHhSIIPYFKEIHAIINDPQNSA 385
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 387 QSLSTFSSHMVNIVGILEQVNE------------------NSLVLFDELGAGTDPQEGAALAMSILDDVHRTNARVLATT 448
gi 3914083 400 QNLSTFSGHICRIIRILQALPSgvqdvldpeidspnhpifPSLVLLDEVGAGTDPTEGSALAIALLRHLADQPCLTVATT 479
gi 3914080 381 QNLSTFSAHVKNMAEFLPKSDE------------------NTLVLIDELGAGTDPIEGSALGIGILEYLKKKKAWVFVTT 442
gi 3914072 386 NSLSTFSSHMSNISYILKHTTK------------------DSLVIFDEFCSGTDIDQGQALAISILEYLININSYVLIST 447
gi 3914057 386 NNISTFAGRMKQFSALLSK--E------------------NMLLGVDEIELGTDADEASSLYKTLLEKLLKQNNQIIITT 445
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 449 HYPELKAYGYNREGVMNASVEFDIETLSPTYKLLIGVPGRSNAFEISKRLGLPDHIIGQAKSEMTAEHNEVDTMIASLEQ 528
gi 3914083 480 HYGELKALKYQDARFENASVEFDDQSLSPTYRLLWGIPGRSNALAIAQRLGLPLAIVEQAKDKLGGFSEDINQVIAGLES 559
gi 3914080 443 HHTPIKLYSTNSDYYTPASVLFDRETLKPLYKIAYNTVGESMAFYIAQKYGIPSEVIEIAKRHVGEFGEQYIKAMEKLSD 522
gi 3914072 448 HYNALKYFAYTHEGVVNASMRMDLETMQPNYNLIFSIPGESYAFNVASKALIDRSIVIRANEIYSSQKTEINEILEKLIE 527
gi 3914057 446 HHKRLSVLMAENKEVELLAALYDEEKERPTYTFLKGVIGKSYAFETALRYGVPHFLIEKAKTFYGEDKEKLNVLIENSSA 525
                      570       580       590       600       610       620       630       640
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 529 SKKRAEEELSETESIRKEAEKLHKELQQQIIELNSKKDKMLEEAEQQAAEKVKAAMKEAEDIIHELRTIK-EEHKSFKDH 607
gi 3914083 560 QRREQEQKAANAQKLLQETEIFYQQVSQKAASLQARERELKSYQDQEVQQAIAAAKEEIAKVIRQLQRGKpSAQKAQQAT 639
gi 3914080 523 YVKKYEEEFRKLEELRKELQKEKEEVEKLRKEYEEAKRKGWKEAYKEAREYLRKLVQESEEIFKKAKEKKeIKEFVSK-- 600
gi 3914072 528 KEKDLLLIKESMDKKLIQIELQEKELENFYQDLLLREKNIETKLLNEQNEFLKNSRKVLENLVREIKEGNiNVAKNKAFI 607
gi 3914057 526 LERELKQKNEHLENALKEQEYLKNAWLLEMEKQKEIFHNKKLELEKSYQQALNILKSEVASKDTSSMHKEiHKASEILS- 604
                      650       660       670       680       690       700       710       720
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 608 ELInakKRLEgampaFEKSKKPEKPKTQKRdfKPGDEVKVLTFGQKGTLLEKTG-GNEWNVQIGILKMKVKEKDLEFIKS 686
gi 3914083 640 EIL---GQIQa----EQKAKVAPKPIGYQP--TVGERIRIPSFGQTAEVTQVNAtAQTVNVTLGLMKMTVPMADIESLNG 710
gi 3914080 601 -------KRE-----EIENLAPQKPQKLEVg------DLVEFMGKKGKVLEVKG--NKALVLVDHLRMWLDTRELQKVGK 660
gi 3914072 608 SDLeknVDLK-----TNKVNSLNNKRNVVAdfKIGDKVRIVNSNAKGKIVGISK--KKITVNVGAFNVSVSSSEISLENF 680
gi 3914057 605 -------KHK------TNQEIPQIITNFQAn------EKARYKNESVLIVQILDkGYYWIETELGMRLKAHGSLLKKIQK 665
                      730       740       750       760       770       780       790       800
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 3914084 687 ---APEPKKEKMITAVKGKD------------YHVSLELDLRGERYENALSRVEKYLDDAVLAGypRVSIIHGKGTGALR 751
gi 3914083 711 kkvEPPPKSEPVPKKVKAEPpateaksppvlvRTEKNTLDCRGDRLERAESRLEKALNQALDAG--VLWIIHGKGTGKLR 788
gi 3914080 661 ---AEPQKETKVTVQTPVME--------------KRDTLNLIGKDVETAVRELEKFIEEAYSAGykVVKVIHGIGSGKLK 723
gi 3914072 681 kekKENGKNFNFSIDYNKEN-------------LLSFTIDIRGMRSVDALDFLNKKIDNIILNGinKFEIIHGKGEGHLM 747
gi 3914057 666 ----PPKNKFKPPKTTIPKP------------KEASLRLDLRGQRSEEALDLLDAFLNDALLGGfeEVLICHGKGSGILE 729
                      810       820       830
               ....*....|....*....|....*....|....
gi 3914084 752 KGVQDLLKNHRSVKSSRFGEAGEGGSGVTVVELK 785
gi 3914083 789 QGVQEYLSHHPLVKSYALAPQNDGGAGVTIAYLR 822
gi 3914080 724 SAVREALSKNEKVKFFRDAYPKEGGSGVTVVYLE 757
gi 3914072 748 REVHNLLKELKFIRKYYFAHPSDGGSGKTIVei- 780
gi 3914057 730 KFVKEFLKNHPKVVSFSDAPINLGGSGVKIVKL- 762
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap