1UAA


Conserved Protein Domain Family
rep

?
TIGR01074: rep 
Click on image for an interactive view with Cn3D
ATP-dependent DNA helicase Rep
Designed to identify rep members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130146
View PSSM: TIGR01074
Aligned: 9 rows
Threshold Bit Score: 1105.96
Threshold Setting Gi: 9107919
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A         2 RLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMI 81
gi 54041576    2 RLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMI 81
gi 6960284     2 RLNPGQQHAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMI 81
gi 1172905     2 KLNPQQQQAVEYVTGPCLVLAGAGSGKTRVIINKIAHLIEKCGYSPKQIAAVTFTNKAAREMKERVAHSIGKEQSKGLLV 81
gi 9107919    25 GLNSPQRAAVLYREGPLLVLAGAGSGKTHVIVEKIAYLITSDCYPAKRIAAITFTNKSAKEMRERVAKQIKSSRADGLTI 104
gi 9951611     3 RLNPRQQEAVNYVGGPLLVLAGAGSGKTSVITRKIAYLVQQCGIRAQYIVAVTFTNKAAREMKERVGTLLRGGEGKGLTV 82
gi 4033461     2 SLNFNQKNAIELINGPCLILAGAGSGKTKVIINKIIYLINNCQYKPGNIIAVTFTNKAAHEIKVRLAKHLNLLQIKKMII 81
gi 488153902   3 KLNPQQLEAVRYLGGPLLVLAGAGSGKTGVITQKIKHLIVNVGYLPHTVAAITFTNKAAAEMQERVAKMLPKPQTRGLTI 82
gi 9654570     2 KLNPRQDEAVKYVSGPCLVLAGAGSGKTRVITNKIAYLVQQCGYKARNIAAVTFTNKAAREMKERVAQTLGKGESRGLMV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A        82 STFHTLGLDIIKREYAALGMKANFSLFDDTDQLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERD 161
gi 54041576   82 STFHTLGLDIIKREYAALGMKANFSLFDDTDQLALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERD 161
gi 6960284    82 STFHTLGLDIIKREYAALGMKSNFSLFDDTDQVALLKELTEGLIEDDKVLLQQLISTISNWKNDLKTPAQAAAGAKGERD 161
gi 1172905    82 STFHTLGFDILKREYKALGFKSNMTLFDEHDQFALLKELTADVLKEDKDLLRELISVISNWKNDLISPKQAFALARDAKY 161
gi 9107919   105 CTFHALGLKFLQIEHDAVGLKPGFSVFDADDADAQINDLLHG---AKQDVIDDTKRRISRAKNAGLSPEQALAAARTTRE 181
gi 9951611    83 STFHNLGLNIIRKEHERLGYKPGFSIFDESDIKALLTDIMQKEY-SGDDGVDEIKNYIGAWKNDLILPEEALEKARNPKE 161
gi 4033461    82 STFHSLGLEIIKKEINTLKFNSNFSLFDERDQMMLLKKICSKSIKNDTKLLKKLVFMISFWKNKFLTPLQVQLSAQSNLE 161
gi 488153902  83 CTFHSLGMKILREEANHIGYKKNFSILDSTDSAKIIGELLGG---TGKEAVFKAQHQISLWKNDLKTPEDVVQTASNIWE 159
gi 9654570    82 STFHTLGLNIIRREFKALGLKAGFSLFDDQDQLALLKELTEKQLDGDKDLLRLLLSTISNWKNDMLTPPQAKAMAKGEQQ 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A       162 RIFAHCYGLYDAHLKACNVLDFDDLILLPTLLLQANEEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVGSRARFTVVG 241
gi 54041576  162 RIFAHCYGLYDAHLKACNVLDFDDLILLPTLLLQRNEEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVGSRARFTVVG 241
gi 6960284   162 RIFAHCYGLYDAHMKACNVLDFDDLILLPTLLLQRNDEVRERWQNKIRYLLVDEYQDTNTSQYELVKLLVGQRARFTVVG 241
gi 1172905   162 QTFAKCYERYATQIRTYNALDFDDLIMLPTLLFKQNEEVRSKWQAKIRYLLVDEYQDTNTSQYELIKLLVGDRACFTVVG 241
gi 9107919   182 MEVATLYARYQARLIAFNAVDFDDLIRLPVQILETSDQVAMAWRERIGYLLVDECQDTNDAQYRLLKVLASPRGNFTCVG 261
gi 9951611   162 QTAAIVYLHYQRTLRAYNAVDFDDLILQPVKLFQEHPDVLQKWQNKVRYMLVDEYQDTNASQYLLVKLLVKDRAQFTVVG 241
gi 4033461   162 KDFAFFYKQYTFHLRKSNILDFDDLICIPTSLLKNNQIIQNRWQKKISYLLVDEYQDTNNSQYELIKMLTNVNSNFTLVG 241
gi 488153902 160 QQTARVYASYQETLQSYQAVDFDDLIRLPAVLLQQNSEVRNKWQRRLRYLLVDECQDTNTCQFTLMKLLTGAEGMFTAVG 239
gi 9654570   162 LLFAHCFELYQKQMQSYNALDFDDLILLPVLLLRSNEEVRQRWQNRIRYLLVDEYQDTNTSQYELVKLLVGERGRLTVVG 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A       242 DDDQSIYSWRGARPQNLVLLSQDFPALKVIKLEQNYRSSGRILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEE 321
gi 54041576  242 DDDQSIYSWRGARPQNLVLLSQDFPALKVIKLEQNYRSSGRILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEE 321
gi 6960284   242 DDDQSIYSWRGARPQNLVLLSQDFPALQVIKLEQNYRSSGRILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEE 321
gi 1172905   242 DDDQSIYSWRGARPENMVRLRDDFPRLNVIKLEQNYRSTQRILHCANILIDNNEHVFDKKLFSTIGKGEKLLVIEAKNEE 321
gi 9107919   262 DDDQSIYAWRGANAENLLQLERDYPQLKVIKLEQNYRCPNRVLRAANALIAHNPHAHLKTLWSDQKDGERIRIWECRDSE 341
gi 9951611   242 DDDQSIYAWRGARPENLMQLKEDFPSLKVVMLEQNYRSTSRILKCANVLIANNPHVFEKQLWSEMGHGDPIRVIRCRNED 321
gi 4033461   242 DDDQSIYSWRGAKPQNLFLIKKDFPNLKIIKMEQNYRSYGRILKAANKLISNNLHYFKKKLFSNLEYGNKIKVIIGKNEK 321
gi 488153902 240 DDDQSIYAWRGANMENLRKMQENYPQMKVIKLEQNYRSTARILKIANKVIENNPKLFTKKLWSQLGEGEPVKVVACQNEQ 319
gi 9654570   242 DDDQSIYSWRGAKPQNLVLLGEDFPSLKLIKLEQNYRSTSRILRAANILIANNPHVYQKALFSELAEGEKLKVILANNED 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A       322 HEAERVTGELIAHHFVN--KTQYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD 399
gi 54041576  322 HEAERVTGELIAHHFVN--KTQYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD 399
gi 6960284   322 HEAERVTGELIAHHFVN--KTQYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD 399
gi 1172905   322 HEAERIVAELIAHRFSR--KTKYKDYAILYRGNHQSRLLEKVLMQNRIPYKISGGTSFFSRAEIKDMMAYLRLVVNQDDD 399
gi 9107919   342 HEAEKIAGEIS--YLGDakQVPWSDFCILFRGNFQSRPLEKALQLLRIPYHLTGGTAFLERQEVKNLLSWLRLLVNPDDD 419
gi 9951611   322 AEAERIAMEIL--TLHLrtERPYSEFAILYRGNHQAKLMELKLQHHQIPYRLSGGTSFFGRQEVKDLMSYFRLLVNPDDD 399
gi 4033461   322 NEAEKIADKIIHECSND--IMQYKDYAILYRGNYQSQILEKTFLKKNIPYDISTNSSFFSRPEIKDLLSYLRLIVNPDDN 399
gi 488153902 320 HEADWVVSQIVKQKLIGgdKTQYADFAVLYRGKHQARIFEEALRGARIPYQLSGGQSFFDKAEIKDVLSYVRLLANPNDD 399
gi 9654570   322 HEAERVIAEIIAHKFLN--RTEYRDYAILYRGNHQSRLIEKSLTQNRVPYKLSGGTSFFARAEIKDIMAYLRVLVNPDDD 399
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A       400 SAFLRIVNTPKREIGPATLKKLGEWAMTRNKSMFTASFDMGLSQTLSGRGYEALTRFTHWLAEIQRLAER-EPIAAVRDL 478
gi 54041576  400 SAFLRIVNTPKREIGPATLKKLGEWAMTRNKSMFTASFDMGLSQTLSGRGYEALTRFTHWLAEIQRLAER-EPIAAVRDL 478
gi 6960284   400 SAFLRIVNTPKREIGPATLQKLGEWAMTRNKSLFTASFDMGLSQKLTGRGYDSLTRFTHWLGEIQRLAER-EPVAAVRDL 478
gi 1172905   400 AAFLRIVNTPKREIGTATLQKLGELAQEKHISLFEAIFEFELIQRITPKAYDSLQKFGRWIVELNDEIQRsEPERAVRSM 479
gi 9107919   420 AAFLRAVQSPKREVGSTSLAKLAELAAAKQMPMSRAAESLGALQQLPARAANGLNKFTDILRELRQQVSRvSAAELVRRL 499
gi 9951611   400 NAFLRVINVPRREIGSATLEKLGNYATQRKISMYAACDEMGLAEHLDSRFHERLQRFKRWMDGIRRQCAEnEPIAVLRSM 479
gi 4033461   400 HAFIRILNIPHRQIGLTTLNKLEELASKKNKSLFQISNDIEIKKILRERTVKKIKDFIYWIKKIIKLSLLkED-IILDKI 478
gi 488153902 400 PAFLRAVTTPKRGIGDVTLGKLNTYAHEHECSLYEAAQNEEALATLNNTNRQHLQTFMDMFVSYLAKAETsEAGEFINSL 479
gi 9654570   400 NAFLRIVNTPKREIGPATLEKLGSYANMRGKSLFTASFELGLEQHLSGRGLENLRRFTEWLVAIADNAERgNTVEAVRAL 479
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A       479 IHGMDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGSELDEP-MTLTQVVTRFTLRDMMERG--ESEEELDQVQLM 555
gi 54041576  479 IHGMDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGSELDEP-MTLTQVVTRFTLRDMMERG--ESEEELDQVQLM 555
gi 6960284   479 IHGIDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGNELDEP-MTLTQVVTRFTLRDMMERG--ESEEELDQVQLM 555
gi 1172905   480 LSAIHYEEYLYEYATSPKAAEMQSKNVATLFDWVADMLKGDETNEP-MNLNQVVTRLTLRDMLERG--EDDDDSDQVQLM 556
gi 9107919   500 AEVSGLLTELREQSNDEASYQRRKRNVEELAEWFE-----GGPFGA--SVGDLVSQLALLSRND-----KDDGGNQVRMM 567
gi 9951611   480 VMDIDYENWLRQNASSDKVAEFRMSNVWFLIEALKNTLERDEEGDM--TIEQAIAKLVLRDMLERQq-EEEEGAEGVQMM 556
gi 4033461   479 INDIKYELWLTKILKEPKKIKTSINNIYTLSNWLKEMLRGNEFEKP-MNLLQIVKKMTLRDILEKKiqINEIPKNRVQLM 557
gi 488153902 480 LEEIDYENHLMQNEEGKAG-EIKWRNVGDLVSWFAR---KGGEDGK--NIIELAQTVALMTLLEGK---DEEETDAVSLS 550
gi 9654570   480 VRDIRYEDWLYETSASPKAAEMRMKNVSDLYSWIVADLEGDNPDQQeKTLKEVVQRLTLRDMMERG--EENDDSDAVQLM 557
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1UAA_A       556 TLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIDEERRLAYVGITRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQ 635
gi 54041576  556 TLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIDEERRLAYVGITRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQ 635
gi 6960284   556 TLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIEEERRLAYVGITRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQ 635
gi 1172905   557 TLHASKGLEFPYVYLIGMEEGILPHQTSIDEDNVEEERRLAYVGITRAQKELTFSLCRERRQYGELVRPEPSRFLAELPN 636
gi 9107919   568 TLHASKGLEFRYVFIAGCEDGVLPHEVSLEEGNVQEERRLLYVGITRAKEQLWMSYSKCARRFGERVRFKPSRFFDELPA 647
gi 9951611   557 TLHASKGLEFPYVFIMGMEEEILPHRSSIEADTVEEERRLAYVGITRARQNLAMTFAAKRKQYGEIIDCSPSRFLDELPP 636
gi 4033461   558 TLHSSKGLEFSSVFIIGMNEGILPNIKSINNDNIEEERRLTYVGMTRARKELFFTYCQTRIQYGQKLYTAPSRFLFELPQ 637
gi 488153902 551 TLHAAKGLEYPYVFLVGCEEGVLPHNDSIEEGNVEEERRLMYVGITRAKRQLTLTHCVKRKKQGTWQFPEPSRFIDEMPQ 630
gi 9654570   558 TLHASKGLEFPYVYLIGAEEGILPHQTSIDEENVEEERRLMYVGITRAQRELTFIVCKERRQFGELIKPSQSRFLDELPQ 637
                        650       660       670
                 ....*....|....*....|....*....|..
1UAA_A       636 DDLI---WEQERKVVSAEERMQKGQSHLANLK 664
gi 54041576  636 DDLI---WEQERKVVSAEERMQKGQSHLANLK 664
gi 6960284   636 DDLI---WEQERKVVSAEERMQKGQSHLANLK 664
gi 1172905   637 DDVL---WERDKPKLTTEQKQEKTQNQLDRLR 665
gi 9107919   648 EELQ---RDGADPVVDAERKQERAKAGLAAIQ 676
gi 9951611   637 EDLE---WEGMEDAP-QEVKAAKGNAALADIR 664
gi 4033461   638 EDLQ---WEKDDYLDAFHTKEKki-------- 658
gi 488153902 631 EDLKilgRKGGEPIVSKEEGRRNLADIIGRLD 662
gi 9654570   638 DDIE---WEVKKKPVTQEERMAKGQAHIANLR 666
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap