Conserved Protein Domain Family
uvrD

?
TIGR01075: uvrD 
DNA helicase II
Designed to identify uvrD members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 130147
View PSSM: TIGR01075
Aligned: 6 rows
Threshold Bit Score: 1195
Threshold Setting Gi: 15676157
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818     6 VLDHLNQNQREAVAAAPGHYLILAGAGSGKTRVLTHRIVWLNEVHGVPTHSMMAVTFTNKAAGEIQQRIDLQLRHGKR-- 83
gi 2625021     6 LLDSLNEKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLLSVENCSPYSIMAVTFTNKAAAEMRHRIEHLIGTSQG-- 83
gi 137194      6 LLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVENCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQG-- 83
gi 9654595     7 LLDGLNDKQREAVAAPLENLLILAGAGSGKTRVLVHRIAWLMSVEEASPFSVMAVTFTNKAAAEMRGRIEELMHGTAS-- 84
gi 1174922     7 LLDGLNDKQRERVAAPLGNHLVLAGAGSGKTRVLTHRIAWLIAVENISEGSIMAVTFTNKAAAEMRHRIQSTLAKHAQhq 86
gi 499289472  10 LLQGLNPEQLSAVTWPPQSALVLAGAGSGKTRVLTTRIAWLLQSGQASVHSIMAVTFTNKAAKEMQTRLGAMIPINVR-- 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818    84 --GMWIGTFHSLAHRLLRLHWNDATLPENFQVIDSDDQLRLVKRVIQSLGLNDTLFPPKQAMWWINTQKDEGRRPEHIQP 161
gi 2625021    84 --GMWIGTFHGLAHRLLRAHHLEANLPQDFQILDSDDQLRLLKRIIKALNVDEKQWPPRQAMWYINGKKDEGLRPQHVET 161
gi 137194     84 --GMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQS 161
gi 9654595    85 --GMWCGTFHGICHRILRAHYLDAKLLEDFQIIDSDDQQRLLKRLIKAHNLDDKQWPARQVAWWINNQKDEGLRPTHINA 162
gi 1174922    87 lfGMWIGTFHSIAHRLLRAHHLDVGLPQDFQILDSEDQLRLIKRLLKLHNFDEKAFPPKQACWYINNKKDEGLRPNDIED 166
gi 499289472  88 --AMWLGTFHGLCHRFLRLHHRDAGLPSSFQILDGGDQLSLIKRLLKSLNIAEEIIAPRSLQGFINAQKESGLRASVLSA 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818   162 ESHdDWIETQRRIYAEYQERCNRAGLVDFAELLLRAHELLRDTPALLTHYRSRFREILIDEFQDTNAIQYAFVRILANET 241
gi 2625021   162 YNN-PVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNVLVDEFQDTNSIQYAWIRLLAGGN 240
gi 137194    162 YGN-PVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDT 240
gi 9654595   163 FD--PVTQTYLKLYTAYQEACDRAGLVDFAEILLRALELLRGNQHIREHYQARFKHILVDEFQDTNAIQYAWLRMMAGAQ 240
gi 1174922   167 FND-RQEREWIKIYQIYQDTCDRAGLVDFAELLIRVYELFEKKPLILQRYQQRFQHILVDEFQDTNKIQYKWIKILAGKT 245
gi 499289472 166 PD--PHTRRMIECYAEYDKICQREGVVDFAELMLRSYEMLQNNEILRQHYQNRFNHILVDEFQDTNKLQYAWLKLIAGNH 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818   242 GHVIAVGDDDQAIYGWRGAKVEHVQHFLKDFPNVQTIRLEQNYRSSANILDAANAIIAHNPDRIGKRLWTESGVGESIDL 321
gi 2625021   241 SNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRLEQNYRSTSNILKAANTLIANNDGRMGKNLWTEGGEGEPISL 320
gi 137194    241 GKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENNNGRLGKKLWTDGADGEPISL 320
gi 9654595   241 SNVMIVGDDDQSIYGWRGARVENIEKFTREFPSVNTIRLEQNYRSTKTILEASNTLIANNSERMGKQLWTDGLVGEPISV 320
gi 1174922   246 GQVMIVGDDDQSIYGWRGAQIENIQKFLKDFK-AETIRLEQNYRSTANILNSANELIANNSDRLGKNLWTEGEKGDPVGI 324
gi 499289472 244 AAVFAVGDDDQSIYRFRGASVGNMTALMEEFHIDAPVKLEQNYRSVGNILAAANAVIENNDERLGKNLRTDAEAGDKIRY 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818   322 YAAYNEIDEARYIVERACQWVRDGGSYGEIAVLYRSNAQSRAFEEVLQSEHIPYRVYGGMRFFERAEIKDALAYLRLLAN 401
gi 2625021   321 YCAFNELDEARFVVNRIKTWQDNGGALNDCAILYRSNAQSRVLEEALLQTAMPYRIYGGQRFFERQEIKDALAYLRLISN 400
gi 137194    321 YCAFNELDEARFVVNRIKTWQDNGGALAECAILYRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIAN 400
gi 9654595   321 YSAYNELDEARFVVSKIKGWQEQGGTLTDCAILYRNNAQSRVLEEALLQASLAYRIYGGMRFFERQEIKDALSYLRLINN 400
gi 1174922   325 YSAFNELDEAKFVASQIQDWVEHGGKLDDCAVLYRSNSQSRVIEEALIRCQIPYRIYGGMRFFERQEIKDALAYLRLINN 404
gi 499289472 324 YSAFTDLEEARFILDETKALEREGWDLDEIAVLYRSNAQSRVIEQSLFRSGIPYKIYGGLRFYERQEIKHALAYLRLAVN 403
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818   402 RSDDAAFERVVNTPVRGIGERTLDEVRHLARTQGLALWDAAMACTQSTTLTARARNALASFLNLLQQLAVETSQMGLAER 481
gi 2625021   401 RNDDAAFERVVNTPTRGIGDRTLDVVRQAARDRQLTLWQATRELMQDKVLAGRAASALQRFIELVESLAHETADMPLHVQ 480
gi 137194    401 RNDDAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASALQRFMELIDALAQETADMPLHVQ 480
gi 9654595   401 RNDDTAFERVINTPPRGLGDKTLETIRFAARDRGCTLWDASVGLLNDQVLTGRAASALSRFVELINALEEEGIDMPLHVL 480
gi 1174922   405 RQDDAAFERVINTPTRGIGDRTLDILRNLTRERQITLWQAVQVATQENMLAGRASTALLRFQELINSLQLDTAEMPLFAQ 484
gi 499289472 404 PDDDNALLRVINFPPRGIGARTVENLQTASNEQGITLWQAACN-------AGAKAAKVVAFVRLIEALRNQVGQLSLSEI 476
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818   482 IDHMLLRSELREHWKKEArgSLDAESRQENLDELVSVASRFV--------LPQNDEDtpiMTELDAFLSYTCLESGDGQV 553
gi 2625021   481 TDRVIRDSGLFIMYEQEK--GEKGQARIENLEELVTATRQFS--------YQDEYQD---LMPLQAFLSHAALEAGEGHA 547
gi 137194    481 TDRVIKDSGLRTMYEQEK--GEKGQTRIENLEELVTATRQFS--------YNEEDED---LMPLQAFLSHAALEAGEGQA 547
gi 9654595   481 TDHAVKTSGLLEMYQQEK--GEKSKARIENLEELVTATRQFE--------KPEEAQE---MTMLTAFLTHAALEAGEGQA 547
gi 1174922   485 TDFVIKHSGLYEMYQQEK--GEKGEVRIENLEELVTATREFI--------KPDNAEE---MTELTAFLTHASLEAGEEQA 551
gi 499289472 477 IVGILKDSGLTEHYRTQK---GDNQDRLDNLDELVNAAIEFKpedsnfeiLPENISDd-pAFPILAFLSNAALESGENQA 552
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818   554 QAGEEGVQLMTLHSAKGLEFPLVFLVGLENGLFPSARSLDEHGRLEEERRLAYVGITRARHKLILSYAEARRIHGKDNYN 633
gi 2625021   548 DAYQDAVQLMTLHSAKGLEFPLVFIVGMEEGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKEVYH 627
gi 137194    548 DTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKEVYH 627
gi 9654595   548 DEHDDAVQLMTLHSAKGLEFPLVFMVGVEEGMFPSQMSAEEAGRLEEERRLCYVGMTRAMQKLYITYAEMRRLYGQDKYH 627
gi 1174922   552 SPHQSCVEMMTLHSAKGLEFPRVFMVGVEEGLFPSFRSFEEPGRLEEERRLAYVGITRAKKKLTISYAESRRLYAKEERH 631
gi 499289472 553 GAGEKAVQLMTVHAAKGLEFNAVFLTGMEEGRFPSEMSLAERGGLEEERRLMYVAITRARKRLYITMAQQRMLHGQTQFG 632
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 9104818   634 IPSRFLREIPRDLLHEVRPTIQVSRQTPLGAVQRPAHDe-rDA-------APIKLGVNVMHPTFGCGVVVDYEGSGAHTR 705
gi 2625021   628 RPSRFIGELPEECVEEVRLRASVSRPVNHRRMGTPISE---ND-------TGYKLGQRVRHPKFGEGTIVNLEGSGEHSR 697
gi 137194    628 RPSRFIGELPEECVEEVRLRATVSRPVSHQRMGTPMVE---ND-------SGYKLGQRVRHAKFGEGTIVNMEGSGEHSR 697
gi 9654595   628 KPSRFIRELPEGCLDEVRMKAQVSRPTSTGRFSQTVVKesfNE-------TGFNLGSRVRHPKFGEGTIINFEGSGPQSR 700
gi 1174922   632 LPSRFIAELPRECIQEIRLRGTVTRAMNLAKVGSLSNTs-aVE-------NEWKMGQKVKHEKFGFGTVINVEGSENNTR 703
gi 499289472 633 IVSRFVEEIPPEVLHYLSVKKPAYDSYGNTRQTAASKDkiiDDykqpqtyAGFRIGQNVRHAKFGTGVIIDAADKGESAR 712
                        730       740
                 ....*....|....*....|.
gi 9104818   706 VQIKFDDVGTKWLVMAYAKLS 726
gi 2625021   698 LQIAFPGEGIKWLVAAYARLE 718
gi 137194    698 LQVAFQGQGIKWLVAAYARLE 718
gi 9654595   701 VQVAFNGEGIKWLVTAYARLE 721
gi 1174922   704 LQIAFQAQGIKWLIAHLAKLE 724
gi 499289472 713 LTINFGKQGVKELDTKFAKLE 733
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap