1FUI


Conserved Protein Domain Family
fucI

?
TIGR01089: fucI 
Click on image for an interactive view with Cn3D
L-fucose isomerase
This enzyme catalyzes the first step in fucose metabolism, and has been characterized in Escherichia coli and Bacteroides thetaiotaomicron. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130161
View PSSM: TIGR01089
Aligned: 4 rows
Threshold Bit Score: 1218.64
Threshold Setting Gi: 2624812
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_A         4 ISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDTCIAGMAEAAACEEKFSSQNVGLT 83
gi 120587      4 ISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDTCIAGMAEAAACEEKFSSQNVGLT 83
gi 491959817  22 snriKIGIRPTIDGRRMGVRESLETQTIRMAQSVAQLLQTHIRHTDGTFVECVVADSTIGGVAEAAACADKFKRENVGLT 101
gi 6015981     2 KKYPKIGIRPTIDGRQGGVRESLEEKTMNLAKAVAELISNNLKNGDGSPVECIIADNTIGRVAESAACAEKFEREGVGST 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_A        84 ITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFA 163
gi 120587     84 ITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFA 163
gi 491959817 102 ITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGAVYLAAALAGHSQLGLPAFSIYGTEVQEADDTNIPEDVKEKLLRFA 181
gi 6015981    82 ITVTSCWCYGAETMDMNPHYPKAVWGFNGTERPGAVYLAAVLAGHAQKGLPAFGIYGRDVQDLDDNTIPEDVAEKILRFA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_A       164 RAGLAVASMKGKSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGED 243
gi 120587    164 RAGLAVASMKGKSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGED 243
gi 491959817 182 RAGLAVASIRGKSYLSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDRKIYDQEEVDLALSWVKQYCKEGVD 261
gi 6015981   162 RAAQAVATMRGKSYLSMGSVSMGIAGSIVNPDFFQEYLGMRNESIDLTEIIRRMEEGIYDHEEYAKAMAWTEKYCKVNEG 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_A       244 E---NNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILN 320
gi 120587    244 E---NNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILN 320
gi 491959817 262 V---NSLENQRNAEERAELWENVVKMTIITRDLMVGNPKLATLNYAEEALGHNAIAAGFQGQRHWTDHLPNGDFMEAMLN 338
gi 6015981   242 EdfkNRPEKRKKREQKDADWEFVVKMMIIMRDLMTGNPKLKEMGFKEEALGHNAIAAGFQGQRQWTDFYPNGDYPEALLN 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_A       321 SSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFADVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDG 400
gi 120587    321 SSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFADVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDG 400
gi 491959817 339 STYDWNGVRPPYILATENDSLNAIGMLFGHQLTGKAQIFADVRTYWSQDSVERVTGWRPE---S-GFIHLINSGSAALDG 414
gi 6015981   322 TSFDWNGIREAFVVATENDACNGVAMLFGHLLTNRAQIFSDVRTYWSPEAVKRVTGKELTGLAANGIIHLINSGATTLDG 401
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_A       401 SCKQRDSEGNPTMKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS 480
gi 120587    401 SCKQRDSEGNPTMKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS 480
gi 491959817 415 TGEHQDAQGNPTLKPAWDVTEEEAKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGIPFTIHRINLIKGLGPVLQIAEGWS 494
gi 6015981   402 SGQSLDAEGNPVMKEPWNLTDADVENCLKATTWYPADRDYFRGGGFSSNFLSKGGMPVTMMRLNLIKGLGPVLQIAEGWT 481
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FUI_A       481 VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMHNVEETK 560
gi 120587    481 VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMHNVEETK 560
gi 491959817 495 IDLPQDVHNKLNQRTNETWPTTWFVPRLTGKGAFTDVYSVMANWGANHCVATHGHVGADLITLASMLRIPVCMHNVSEKN 574
gi 6015981   482 VEIDPEIHQKLNMRTDPTWPTTWFVPRLCDKSAFKDVYSVMNNWGANHGAISYGHIGQDLITLASMLRIPVCMHNVDENE 561
                        570       580       590
                 ....*....|....*....|....*....|
1FUI_A       561 VYRPSAWAAHGMDIEGQDYRACQNYGPLYK 590
gi 120587    561 VYRPSAWAAHGMDIEGQDYRACQNYGPLYK 590
gi 491959817 575 IFRPSAWNGFGQDKEGQDYRACQNFGPLYK 604
gi 6015981   562 IFRPTAWNAFGMDKEGADYRACTTYGPIYK 591
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap