Conserved Protein Domain Family
V_ATP_synt_C

?
TIGR01100: V_ATP_synt_C 
vacuolar ATP synthase 16 kDa proteolipid subunit
This model describes the vacuolar ATP synthase 16 kDa proteolipid subunit in eukaryotes and includes members from diverse groups e.g., fungi, plants, parasites etc. The principal role V-ATPases are the acidification of intracellular compartments of eukaryotic cells. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130170
View PSSM: TIGR01100
Aligned: 17 rows
Threshold Bit Score: 139.059
Threshold Setting Gi: 7530126
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755150    13 FFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKsYYLFDG 92
gi 1200116   13 FFGFLGAAAALVFSCMGAAYGTAKSGVGVACMGVMRPELVMKSIVPVVMAGVLGIYGLIIALIISTGINPKTKsYYLFDG 92
gi 2605483   21 FFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIST--NVKRDvYKLYDG 98
gi 2493143   11 FFGSIGCAAAIVFTCFGASYGTAKSGVGICATSVTRPDLLVKNVVPVVMAGIIAIYGLVVSVLVSDSLSQKQ---ALYTG 87
gi 401335    11 FFGAMGCTAAIVFTCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISDALTQDHY--ALYTG 88
gi 1718096   12 FFGVMGCTAAIVFASFGAAYGTAKAGVGISAMGVLRPDLIVKNTIPVVMAGIIAIYGLVVSVLISGNLKQIL---SLYSG 88
gi 418179    12 FFGVIGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTED---ISLFKS 88
gi 2493142   12 FFGVMGAASAMVFSALGAAYGTAKSGVGISAMSVMRPELIMKCIIPVVMAGIIAIYGLVVAVLIAGKLDEAPT-YTLYQG 90
gi 2506212   16 FFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMVLKGKVTSASAgYDLNKG 95
gi 66821788  30 FFGAMGVTAALVFTVMGAAYGTAKASVGISNMGVMKPDLVIKAFIPVIFAGVIAIYGLIICVILVGGIKPNAN-YTLMKS 108
                        90       100
                ....*....|....*....|....*....
gi 755150    93 YAHLSSGLACGLAGLSAGMAIGIVGDAGV 121
gi 1200116   93 YAHLSSGLACGLAGLSAGMAIGIVGDAGV 121
gi 2605483   99 YAHLSAGLACGLAGLPAGMAIGIVGDAGV 127
gi 2493143   88 FIQLGAGLSVGLSGLAAGFAIGIVGDAGV 116
gi 401335    89 FIQLGAGLAVGLAGLAAGFAIGIVGDAGV 117
gi 1718096   89 FIQLGAGLSVGLAGLAAGFAIGIVGDAGV 117
gi 418179    89 FLQLGAGLSVGLSGLAAGFAIGIVGDAGV 117
gi 2493142   91 FVHMGAGLSVGLSGLAAGFAIGIVGDAGV 119
gi 2506212   96 FAHLAAGLTCGLCGLGAGYAIGIVGDAGV 124
gi 66821788 109 FTDLGAGLTVGLCGLAAGMAIGIVGDSGV 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap