Conserved Protein Domain Family
mtrA

?
TIGR01111: mtrA 
N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit A
This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit A in methanogenic archaea. This methyltranferase is a membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase (encoded by subunit A) is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of methyl-coenzyme M by another enzyme, methyl-coenzyme M reductase. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130181
View PSSM: TIGR01111
Aligned: 5 rows
Threshold Bit Score: 360.667
Threshold Setting Gi: 2330614
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62297851    1 MANKREPAPGWPIVSGEYVVGNPESCVGVVTLGSHGLEQACIDAG---AAIAGPCHTENLGIEKVVANYISNPNIRFMIL 77
gi 2330614     1 MPEKAEPAEGWPVVEGDYVVGDPEAPVHVVTLGSHIEEDILKAAGedkVAIAGPCKTENIGIEKVIANVIANPNIRFGVL 80
gi 4691341     1 MADKKEPAPGWPILKGEYEVGDVKNCVLVITCGSHLPGQPILDAG---AAVTGSCKTENLGIEKVVAHIISNPNIRYLLV 77
gi 22002051    1 MADKREPAPGWPILKGEYEVGDVKNSVLVITCGSHLPGKPILDAG---AACTGSCKTENLGIEKVVAHIISNPNIRYLLV 77
gi 503061356   1 MVEKKSPAEGWPVVNGDYIVGDPESPVAATTLASHIED-IPVEAG---AAIAGPCKTENLGIEKMIANLISNPNIRFLIL 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62297851   78 CGSEVQGHITGQCFKALWENGIG-DDGGIIGAKGAIPFLENVNKEAVERFRRQIvEVVDLIDCEDIGKITQAIKECLSKD 156
gi 2330614    81 CGAEVTGHLTGQCFKAMYENGVDpDSGEIIGAEGAIPYLENIPEEAVERYRDQIvELVDLIDVEDVDEIVKAIEECVEKD 160
gi 4691341    78 TGSEVKGHITGQSVMSLHANGVK--DNRISGALGAIPYVENLNEDAIARFQEQV-DVVNLLDTEDMGAITSKVKELASKD 154
gi 22002051   78 TGSEVKGHITGQSMMSLHANGVK--ENRIAGALGAIPYVENLNAAAVARFQEQV-QVVNLLDTEDMGAITSKVRELASKD 154
gi 503061356  77 CGSEVQGHITGQSIEALHQNGVDpDKRNIIGATGAIPYIENIPDEGIERFQKQL-EIVNLIDVEDADAIKAKVKECIEKD 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62297851  157 PGAIDEDPFIIELEggKGgGEEEEGVIK--PITPEMAIIESRMRLIGNEMCYNGLLAKWQAGYYNGKIQGIATGLFLMLL 234
gi 2330614   161 PGAYEEGPMTISLE--EE-EEEELAEVAgmPVSAETVTVEYRINDVRVGVKSIGAMQRYMAGYLSGRTMGLLIGIISGMI 237
gi 4691341   155 PGAFDAEPMIVEISe-EGeEEEEGGAVR--PVSGEIAVIRSRLKAIEARMMDIGNLNKFHSGVHAGKIEGAMIGLTVTIS 231
gi 22002051  155 PGAFDADPLVVEISe-EGeEEEEGGVVR--PVSGEIAVLRSRLKAIEARMMDIGNLNKFHSGVHAGKVEGAMIGLTITIS 231
gi 503061356 156 PGAFEEEAMIIKVE--EGgEEEEGEEVK--PVAPETALIEARMRNIQTQVKMIGSTNRMFAGMYSGKVQGIMIGLAFTLT 231

                 ....*.
gi 62297851  235 IMGILM 240
gi 2330614   238 FLFLPM 243
gi 4691341   232 LLGLLL 237
gi 22002051  232 LLGLLL 237
gi 503061356 232 LGILLL 237
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap