Conserved Protein Domain Family
mtrE

?
TIGR01113: mtrE 
N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit E
This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit E in methanogenic archaea. This methyltranfersae is membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of methyl-coenzyme M by another enzyme methyl-coenzyme M reductase. [Transport and binding proteins, Cations and iron carrying compounds, Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 130183
View PSSM: TIGR01113
Aligned: 5 rows
Threshold Bit Score: 397.686
Threshold Setting Gi: 2497846
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6166573   7 MGVLALIGVAATIAGASEDLESDIGSQSNPNSQVQLAPQMMFPHRIFNKAISGEPPSNALMCSIGAAIATVLIsEFTVSP 86
gi 2497847   8 LGALALSGALATVAGCAEDLESDVGSQSNPNSQVQLAPQMGNIHRYFNKAISGEPVSYGLYVAVAGTVAYAIM-QMGLNP 86
gi 6093438   7 IGLAAAMGALATIAGAFEDAESDVGSQSNPNSQVQLAPQMMNFHRYFNKAISGEPVSYMLYGAIAGTVTWVMMtKFGLPF 86
gi 3334267   8 LGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSGEPVAYGTWCGIAGSVAYVLMqSMQLPV 87
gi 2497846   8 LGILALTTASAIIGQTIEDVETNIGSQSNPNSQVQLAPQMGNLHRFFNKAIAGEPFAYCTFCGVSGAITVATL-YLHLPA 86
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6166573  87 LFALVFGSVIAASVHATFAVTATMGRCAS-QSRFKQPIYLDMIRSHTPAIMGYAFITTFCVLIVSYLMTVVLG---HPFP 162
gi 2497847  87 ILALILGAGVAAFVHGAYAISAYLGRIVGqSKNFGQPVYWDVVMSHLGPIVGHGFIAVFCMVLMAYLANTILG---NPFP 163
gi 6093438  87 LAAAAVGVGVNALIHMVFATTAHLGRMAS-AAEFGHPIYLDVVLSHLGPIAGFGGIATFAIVSLAYIQWALLK---HPFP 162
gi 3334267  88 IMAIAVGAVIAAMVHTTYAVTSHMGRIVS-QSQFNQPLFMDMLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPgfaHPFP 166
gi 2497846  87 VIALAIGAAITTLIWLAYSTTAYLGRVSG-SATFNQPVFLDMLTENLGPIAGHAFIVFFCMTGVAYLMTLPVKgfaHPFP 165
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6166573 163 LTMLAFIWGITIGAIGSSTGDVHYGAEREFQQFEFGSGLNASNSGNIVRYAESGLRNGFDNSWFCSKFGGPTTGIAFGMT 242
gi 2497847 164 LPLIALIFGITVGAIGSSTGDVHYGAEREYQKYPFGGGVPVANHGDIDIKAEYGLRNGMDSSYFCSRLGGVLTGLCFGLI 243
gi 6093438 163 LPLLAALWGVTVGAIGSSTGDVHYGAERLYQHYPFGGGVPVAAHGNITRKAETGIRNSMDSVYFCAKFGNPLTGLCFGLV 242
gi 3334267 167 LPLLAVLWGITIGAIGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTGFAFGAI 246
gi 2497846 166 IPVIGMIWGMTIGAIGSAVGDVYYGAEAEFVHKKFGGGIPVASHGDITRKGVLGARSPMEVGNFTVKYGSPITGMAFGLI 245
                      250       260       270       280       290
               ....*....|....*....|....*....|....*....|....*....|....*...
gi 6166573 243 VFLGSWITTIFDp----AQGLSMGwl--svIAGVIIVLILIIWNWKIEVQARKAYGPY 294
gi 2497847 244 VFLDGWRGVLGDilkggQGGSVITasiisiVIGLIIVAILAIINRKVEVFARNKYGPY 301
gi 6093438 243 VFFSTWAGLFG------QWGAVI-------AMGLVTLGCLIVSNR-VEKKARESYGTY 286
gi 3334267 247 VFLSFWNTIVFG-----ITGGIIS--------GLIIVLLLIILNNRLEVFARNRYGPY 291
gi 2497846 246 VLS--ITR-----------G---------------------VYN--IE---------- 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap