Conserved Protein Domain Family
mmdA

?
TIGR01117: mmdA 
methylmalonyl-CoA decarboxylase alpha subunit
This model describes methymalonyl-CoA decarboxylase aplha subunit in archaea and bacteria. Metylmalonyl-CoA decarboxylase Na+ pump is a representative of a class of Na+ transport decarboxylases that couples the energy derived by decarboxylation of carboxylic acid substrates to drive the extrusion of Na+ ion across the membrane. [Energy metabolism, ATP-proton motive force interconversion, Energy metabolism, Fermentation, Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130187
View PSSM: TIGR01117
Aligned: 4 rows
Threshold Bit Score: 947.352
Threshold Setting Gi: 415593
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 415593      6 EKIELLHEKLAKVKAGGGEKRVEKQHAQGKMTARERLAKLFDDNSFVELDQFVKHRCVNFGQEKKELPGEGVVTGYGTID 85
gi 2706398     1 KKIQDLQKKKEKIALGGGIKRIEKQHASGKMTARERLAYLFDEGTFVEMDAFVQHRCTNFGMDKQDLPSESVVTGYGMVD 80
gi 499182166   4 ELVEELYGKKEKIRQMGGKERIERQHEQGKLTARERIELLLDPGSFVEINPFVEKRNTDFGLDKMDLPADGVVTGYGTVD 83
gi 499187833   5 EKVEELHERKKKILQMGGEEAIKKQHEKGKLTARERLELLLDPGSFVEIGMFVKHRATEFGMDKRELPADGVITGYGTIN 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 415593     86 GRLVYAFAQDFTVEGGSLGEMHAAKIVKVQRLAMKMGAPIVGINDSGGARIQEAVDALAGYGKIFFENTNASGVIPQISV 165
gi 2706398    81 GRVVYAFSQDFTVTGGALGEMHAKKICKAMDMAGKVGAPVVGLNDSGGARIQEAVDALSGYGDIFYRNSIYSGVVPQISA 160
gi 499182166  84 GRPVAVFAQDFTVMGGSLGEMHGFKIAYILDFAMKLGIPVVGLNDSGGARIQEGVDALKGYGDIFYRNTLASGVIPQISV 163
gi 499187833  85 GRLVFVYAQDFTVMGGSLGEMHAMKIKRIMELALEAGAPVIGLNDSGGARIQEGVDSLKGYGEIFKMNTILSGVVPQITA 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 415593    166 IMGPCAGGAVYSPALTDFIYMVKN-TSQMFITGPAVIKSVTGEEVTAEDLGGAMAHNSVSGVAHFAAENEDDCIAQIRYL 244
gi 2706398   161 ILGPCAGGAVYSPALTDFIFMVDQ-TSQMFITGPQVIKTVTGEEVTAEQLGGAMTHNSTSGCAQFISQDDKACIDDIRRL 239
gi 499182166 164 IMGPCAGGAVYSPAIGDFIVMTKNpNCYMFITGPQVIKTVTGEEVSAFDLGGWQAHAMKSGNCHLVAEDDRDAMMLVRRL 243
gi 499187833 165 IMGPCAGGAVYSPAIGDFILMVDNpSTFMFITGPQVVKAVTGVEVTPVQLGGAMVHAQRSGQAHLIGKSDEEVIMLIKKL 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 415593    245 LGFLPSNNMEDAPLVDTGDDPTREDESLNSLLPDNSNMPYDMKDVIAATVD-----NGEYYEVQPFYATNIITCFARFDG 319
gi 2706398   240 ISFLPSNNMEKAPEFGCEDDLNIQFPELDALMPDNPNKAYNMFDVITKIVD-----NGDYMEYQPHYSKNIITCFARVNG 314
gi 499182166 244 LSYLPLNNMEDPPVVKTGDDPVRLTPEIYDVLPDDPQKPYDVRDVITAVVD-----NGELLEIHPYYAPNAVVGFARIDG 318
gi 499187833 245 LSYLPSNNMEKPPRVKPKDEPFRRTPELYDIVPDDPNKGYDVRQVIYTIVDrdengNPDFLELQPYFAPNAVIGFGRING 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 415593    320 QSVGIIANQPKVMAGCLDINASDKSSRFIRFCDAFNIPIVNFVDVPGFLPGTNQEWGGIIRHGAKMLYAYSEATVPKITV 399
gi 2706398   315 KSVGIIANQPQVMAGCLDIDSGDKCAKFIRTCDAFNIPLLTIVDVPGFLPGVTQEYGGIIRHGAKILYAYSEATVPKVTL 394
gi 499182166 319 KSVGIVANNPRHFAGCLDVDSSDKIARFVRFCDAFNIPIITFVDVPGYLPGVQQEYGGIIRHGAKVLYAYSEATVPLVTI 398
gi 499187833 325 QPVGIVANNPIHLAGVLDIDSSDKIARFVRFCDAFNIPIVTFVDVPGYLPGVDQESRGIIRHGAKVLYAYAEATVPMVTI 404
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 415593    400 ITRKAYGGSYLAMCSQDLGADQVYAWPTSEIAVMGPAGAANIIFKKD--EDKD------AKTAKYVEEFATPYKAAERGF 471
gi 2706398   395 ITRKAYGGAYVAMCSKSLGADVVLAWPTAEIAVMGPAGAVNIIFRKDikDAKDpaattkQKLDEYTTEFANPYQAARRGL 474
gi 499182166 399 ILRKAYGGAYLAMGSKHLGADIVYAYPTAEIAVMGPEGAAEIVFRKEikAAEDpkamreEKIREYREKFANPYRAAARGY 478
gi 499187833 405 ILRKAYGGAYLAMGSKHLGADFVFAWPTAEIAVMGPEGAANIIFRKEiaKAENpeefrrQKIQEYREKFANPYVAAARGY 484
                        490       500       510
                 ....*....|....*....|....*....|....*...
gi 415593    472 VDVVIEPKQTRPAVINALAMLASKRENRAPKKHGNIPL 509
gi 2706398   475 VDDVIEPKTSRQRIVDAFNMLEGKREKLPAKKHGNIPL 512
gi 499182166 479 IDDIIDPKYTRVKVVSALRILESKREKLPPKKHGNIPL 516
gi 499187833 485 IDDVIDPAETRAKIVMALEALENKRVKLPPKKHGNIPL 522
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap