Conserved Protein Domain Family
lacA

?
TIGR01118: lacA 
galactose-6-phosphate isomerase, LacA subunit
This family contains members from low GC gram-positive bacteria. Galactose-6-phosphate isomerase is involved in lactose catabolism by the tagatose-6-phosphate pathway. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130188
View PSSM: TIGR01118
Aligned: 3 rows
Threshold Bit Score: 242.926
Threshold Setting Gi: 125907
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125908   1 MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVTEGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGTGSFMVATKIKGMI 80
gi 125909   1 MAIIIGSDAAGKRLKDVIKTFLKDNNHEVLDVTERKDLDFVDSTLAVVHEVQKNDKNLGIAIDAYGAGSFMVATKVKGMI 80
gi 125907   1 MAIVVGADLKGTRLKDVVKNFLVEEGFEVIDVTK-DGQDFVDVTLAVASEVNKDEQNLGIVIDAYGAGPFMVATKIKGMV 79
                      90       100       110       120       130       140
              ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 125908  81 AAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKYDGGRHQIRVDMLNKM 141
gi 125909  81 AAEVSDERSAYMTRGHNNARIITLGAEIVGDELAKNIVKDFVEAKYDGGRHQIRVDMLNKM 141
gi 125907  80 AAEVSDERSAYMTRGHNNARMITVGAEIVGDELAKNIAKAFVNGKYDGGRHQVRVDMLNKM 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap