Conserved Protein Domain Family
lacB

?
TIGR01119: lacB 
galactose-6-phosphate isomerase, LacB subunit
This family contains four members from low GC gram-positive bacteria. Galactose-6-phosphate isomerase is involved in lactose catabolism by the tagatose-6-phosphate pathway. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130189
View PSSM: TIGR01119
Aligned: 3 rows
Threshold Bit Score: 352.732
Threshold Setting Gi: 125915
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125915   1 MRIAIGCDHIVTDVKMAVSEFLKSKGYEVLDFGTYDHVRTHYPIYGKKVGEAVVSGQADLGVCICGTGVGINNAVNKVPG 80
gi 125919   1 MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVGINNAVNKVPG 80
gi 153674   1 MKIAIGCDHIWTDVKMELSKHIKEEGYEVLDVGTYDFTRTHYPIFGKKVGEAVSSGEADLGVCMCGTGVGISNAANKVPG 80
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125915  81 VRSALVRDMTSALYAKEELNANVIGFGGMITGGLLMNDIIEAFIEAEYKPTEENKKLIAKIEHVETHNAHQADEEFFTEF 160
gi 125919  81 VRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAKIKHLETSNADQADPHFFDEF 160
gi 153674  81 VRTALVRDMTSALYSKEELNANVVSFGGAIIGKLLLFDIVDAFIKAQYKPTEENKKLIAKIKHLEAHNDKQADPHFFDEF 160
                     170
              ....*....|.
gi 125915 161 LEKWDRGEYHD 171
gi 125919 161 LEKWDRGEYHD 171
gi 153674 161 LEKWNRGDYHD 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap