3LQS


Conserved Protein Domain Family
D_amino_aminoT

?
TIGR01121: D_amino_aminoT 
Click on image for an interactive view with Cn3D
D-amino acid aminotransferase
This enzyme is a homodimer. The pyridoxal phosphate attachment site is the Lys at position 146 of the seed alignment, in the motif Cys-Asp-Ile-Lys-Ser-Leu-Asn. Specificity is broad for various D-amino acids, and differs among members of the family; the family is designated equivalog, but with this caveat attached. [Energy metabolism, Amino acids and amines]
Statistics
?
PSSM-Id: 130191
View PSSM: TIGR01121
Aligned: 7 rows
Threshold Bit Score: 470.373
Threshold Setting Gi: 17433704
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3LQS_A        2 YTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITIPYTKDKFHQLLHELVEKNE 81
gi 1706292    2 KVLFNGRLMERSECAVDIEDRGYQFGDGVYEVIRIYNGILFTLDEHIARLYKSAAEIGIDLSFSEAELKSQLKELVDINQ 81
gi 3121979    2 KVLVNGRLIGRSEASIDLEDRGYQFGDGIYEVIRVYKGVLFGLREHAERFFRSAAEIGISLPFSIEDLEWDLQKLVQENA 81
gi 1706294    3 KVFINGEFIDQNEAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVTEHFERFIRSASEIQLDLGYTVEELIDVVRELLKVNN 82
gi 142542     3 YTLWNDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITIPYTKDKFHQLLHELVEKNE 82
gi 1706293    3 YSLWNDQIVEEGSITISPEDRGYQFGDGIYEVIKVYNGHMFTAQEHIDRFYASAEKIRLVIPYTKDVLHKLLHDLIEKNN 82
gi 17433704   2 KVLVNNHLVEREDATVDIEDRGYQFGDGVYEVVRLYNGKFFTYNEHIDRLYASAAKIDLVIPYSKEELRELLEKLVAENN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3LQS_A       82 LNTGHIYFQVTRGTS-PRAHQFPENt-VKPVIIGYTKENPRPLENLEKGVKATFVEDIRWLRCDIKSLNLLGAVLAKQEA 159
gi 1706292   82 RRDGGLYLQVTRGKA-PRKHQYGAG--LTPQVTAYTFPIQKPEKEQQNGVSAITADDMRWLRCDIKSLNLLYNVMIKQKA 158
gi 3121979   82 VSEGAVYIQTTRGVA-PRKHQYEAG--LEPQTTAYTFTVKKPEQEQAYGVAAITDEDLRWLRCDIKSLNLLYNVMTKQRA 158
gi 1706294   83 IQNGGIYIQATRGVA-PRNHSFPTPe-VKPVIMAFAKSYDRPYDDLENGINAATVEDIRWLRCDIKSLNLLGNVLAKEYA 160
gi 142542    83 LNTGHIYFQVTRGTS-PRAHQFPENt-VKPVIIGYTKENPRPLENLEKGVKATFVEDIRWLRCDIKSLNLLGAVLAKQEA 160
gi 1706293   83 LNTGHVYFQITRGTT-SRNHIFPDAs-VPAVLTGNVKTGERSIENFEKGVKATLVEDVRWLRCDIKSLNLLGAVLAKQEA 160
gi 17433704  82 INTGNVYLQVTRGVQnPRNHVIPDDfpLEGVLTAAAREVPRNERQFVEGGTAITEEDVRWLRCDIKSLNLLGNILAKNKA 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3LQS_A      160 HEKGCYEAILHRNNTVTEGSSSNVFGIKDGILYTHPANNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVT 239
gi 1706292  159 QEASAFEAILIRDGLVTEGTSSNVYVAKQNVIYTHPVTTLILNGITRMKVLQLCEENGLNYEEKAVTKDELLNADEVFIT 238
gi 3121979  159 YEAGAFEAILLRDGVVTEGTSSNVYAVINGTVRTHPANRLILNGITRMNILGLIEKNGIKLDETPVSEEELKQAEEIFIS 238
gi 1706294  161 VKYNAGEAIQHRGETVTEGASSNVYAIKDGAIYTHPVNNYILNGITRKVIKWISEDEDIPFKEETFTVEFLKNADEVIVS 240
gi 142542   161 HEKGCYEAILHRNNTVTEGSSSNVFGIKDGILYTHPANNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVT 240
gi 1706293  161 SEKGCYEAILHRGDIITECSSANVYGIKDGKLYTHPANNYILNGITRQVILKCAAEINLPVIEEPMTKGDLLTMDEIIVS 240
gi 17433704 162 HQQNALEAILHRGEQVTECSASNVSIIKDGVLWTHAADNLILNGITRQVIIDVAKKNGIPVKEADFTLTDLREADEVFIS 241
                       250       260       270
                ....*....|....*....|....*....|....*...
3LQS_A      240 STTSEITPVIEIDGKLIRDGKVGEWTRKLQKQFETKIP 277
gi 1706292  239 STTAEVIPVTSIDGQTIGSGAPGPLTKNVQTALQNSIL 276
gi 3121979  239 STTAEIIPVVTLDGQSIGSGKPGPVTKQLQAAFQESIQ 276
gi 1706294  241 STSAEVTPVVKIDGEQVGDGKVGPVTRQLQEGFNKYIE 278
gi 142542   241 STTSEITPVIEIDGKLIRDGKVGEWTRKLQKQFETKIP 278
gi 1706293  241 SVSSEVTPVIDVDGQQIGAGVPGEWTRKLQKAFEAKLP 278
gi 17433704 242 STTIEITPITHIDGVQVADGKRGPITAQLHQYFVEEIT 279
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap