1I1K


Conserved Protein Domain Family
ilvE_I

?
TIGR01122: ilvE_I 
Click on image for an interactive view with Cn3D
branched-chain amino acid aminotransferase, group I
Among the class IV aminotransferases are two phylogenetically separable groups of branched-chain amino acid aminotransferase (IlvE). The last common ancestor of the two lineages appears also to have given rise to a family of D-amino acid aminotransferases (DAAT). This model represents the IlvE family more strongly similar to the DAAT family. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 130192
View PSSM: TIGR01122
Aligned: 11 rows
Threshold Bit Score: 443.339
Threshold Setting Gi: 11498538
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1I1K_A        10 WFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHK--GPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVI 87
gi 148177     10 WFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHK--GPVVFRHREHMQRLHDSAKIYRFPVSQSIDELMEACRDVI 87
gi 669402215  10 WFNGEMIPWANATVHVLTHAMHYGTSVFEGVRCYNTPK--GPIIFRHREHAQRLLDSAKIYRFPIPYSIETIMEATRETL 87
gi 500032797   9 WMDGQFVDWRDAKIHVLTHTLHYGMGVFEGIRCYEADQ--GPAIFRLGEHVERLFKSALILGMEMPYSRDVISQVCQDVI 86
gi 489186367  11 WYDGELVQWRDATTHVLTHTLHYGMGVFEGVRAYDTPQ--GTAIFRLQAHTDRLFDSAHIMNMQIPYSRDEINEATRAAV 88
gi 499206024  13 WMDGEFVDWEDAQVHVLTHALHYGSGIFEGVRVYDTDN--GPAIFRWDDHLQRFYESAKPYDLDIEFTPDELTDATVELI 90
gi 488940853   8 WMDGKLVDFKDATLHFLTHSLHYGNAVFEGTRAYKTDK--GLAIFRLEDHTKRLLESAKITLLNCPFSQKELENAQIELL 85
gi 499183697  11 FFEGKIVPVEEAKISIMTNSFHYGTAIFEGIRAYWNEEeeQLYILFAKEHYERLLTNARCLFMELNYSAEELVEITKEIL 90
gi 499172934   4 YLNGKFVDEKDAKVSVFDHGLLYGDGVFEGIRAYDG------VVFMLKEHIDRLYDSAKSLCIDIPLTKEEMIDVVLETL 77
gi 499180893   5 YMDGEFVPENEAKVSIFDHGFLYGDGVFEGIRAYNG------RVFRLKEHIDRLYDSAKAIDLEIPITKEEFMEIILETL 78
gi 3122274    10 WLNGEMVEWEEATVHVLSHVVHYGSSVFEGIRCYRNSK--GSAIFRLREHVKRLFDSAKIYRMDIPYTQEQICDAIVETV 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1I1K_A        88 RKNNLT-S-AYIRPLIFVGDVGMGVNPp-AGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGN 164
gi 148177     88 RKNNLT-S-AYIRPLIFVGDVGMGVNPp-AGYSTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRARPNTIPTAAKAGGN 164
gi 669402215  88 RVNKLD-N-AYIRPLAYVGNVGLGVCPp-VGTEMDLMIAAFPWGAYLGEEALENGVDAMVSSWHRAAPNTIPTAAKAGGN 164
gi 500032797  87 KLNGLK-S-GYIRPLMYYGAESMGINP--APLKTHGMVAAWAWGAYLGEEGMEKGIRIKTSSYTRHHPNVVMTRAKAVGN 162
gi 489186367  89 RENNLE-S-AYIRPMVFYGSEGMGLRA--SGLKVHVIIAAWSWGAYMGEEALQQGIKVRTSSFTRHHVNISMTRAKSNGA 164
gi 499206024  91 QRQDLG-S-CYIRPLAYYGYESLGVSP--GDCPTDVAIAAWPWGAYLGDDALENGVDVMVSTWRKHASSQIPTNAKTTGL 166
gi 488940853  86 KANNFK-SnVYIRPLIFLGDGVMGLYH--IKAPVRVGIAAWEWGAYLGEEGLEKGIKVKISSFARNSVKSCMGKAKASAN 162
gi 499183697  91 RKSEIReD-VYIRPIAY--FKDLKLTPklIDYTPEIAIYLYRFGRYLDT---SKGIRAKVSSWRRNDDNSIPSRWKVAGA 164
gi 499172934  78 RVNNLRd--AYIRLVVTRGVGDLGLDPrkCG-KPTIFCIAIPMPPLLG----EDGIRAITVSVRRLPVDVLNPAVKSLN- 149
gi 499180893  79 RKNNLRd--AYIRPIVTRGIGDLGLDPrkCQ-NPSIIVITKPWGKLYGDL-YEKGLTAITVAVRRNSFDALPPNIKSLN- 153
gi 3122274    88 RENGLE-E-CYIRPVVFRGYGEMGVHP--VNCPVDVAVAAWEWGAYLGAEALEVGVDAGVSTWRRMAPNTMPNMAKAGGN 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1I1K_A       165 YLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLA-KELGIEVREQV-L 242
gi 148177    165 YLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLA-KELGIEVREQV-L 242
gi 669402215 165 YLSSLLVGGEARRHGYAEGIALSVDGYLSEGAGENIFVVKNGVILTPPTTSSILPGITRDSIMTLA-RDMGYEVREAN-I 242
gi 500032797 163 YPNSILAKSEALRCGYDEALLLDTEGYVAEGSGENLFLVQGQTLKTPPL-DSALNGITRNTVMTIA-AEMGLKVVEQR-F 239
gi 489186367 165 YINSMLALQEAISGGADEAMMLDPEGYVAEGSGENIFIIKDGVIYTPEVT-ACLNGITRNTILTLA-AEHGFKLVEKR-I 241
gi 499206024 167 YVNSMLAGEEARRNGFTEAIVLNKEGNVAEGPGENIFLVRDGELFTPGLSESILDGITRDTVITLA-EERGYTVHDDVsI 245
gi 488940853 163 YLNSQIAKFEAIEAGYEEALMLDEEGFIAEGTGECFFIVKDGVLITPP-NDFSLKSITQDTVLKIA-HDLGITVLRQR-I 239
gi 499183697 165 YVNSALAKTEALMSGYDEAILLNSQGYVAEGSGENIFIIKNGKAITPSPNEHILEGITRNAVITLLkKELVVEVEERP-I 243
gi 499172934 150 YLNSVLAKIQANYAGVDEAFLLDDKGFVVEGTGDNIFIVKNGVLKTPPVYQSILKGITRDVVIKLA-KEEGIEVVEEP-L 227
gi 499180893 154 YLNNILAKIEANAKGGDEAIFLDRNGYVSEGSGDNIFVVKNGAITTPPTIN-NLRGITREAVIEII-NRLGIPFKETN-I 230
gi 3122274   164 YLNSQLAKMEAVRHGYDEAIMLDYHGYISEGSGENIFLVSEGEIYTPPVSSSLLRGITRDSVIKIA-RTEGVTVHEEP-I 241
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
1I1K_A       243 SRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTG-ETEDKWGWLDQV 307
gi 148177    243 SRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTG-ETEDKWGWLDQV 307
gi 669402215 243 SREALYLADEIFMTGTAAEVVPVRSVDKITVGAGKRGPITKVVQDAYFGLFKG-TTEDKWGWLDYV 307
gi 500032797 240 PRDEVLVSDEAFFTGTAAEVTPIRELDDRQIGPGHAGPVTKEVQKRFFDIVHG-RDPKHMGWLTPV 304
gi 489186367 242 TRDEVYIADEAFFTGTAAEVTPIREVDGRKIGAGRRGPVTEKLQKAYFDLVSG-KTEAHAEWRTLV 306
gi 499206024 246 SRGELHTADELFFTGSAAEVTPIKQVDNVEIGSGTRGPVTEELQTAFFDLVEA-G--DREEWFHYV 308
gi 488940853 240 SRDEVYTADEAFFTGTAAEITPINNIDARIIGNGLRGSVTKKLQDAYFDVVYG-RNEKYASMLTYI 304
gi 499183697 244 ARSELYTADEVFLTGTAAEVTPVVEIDNRKIGNGEIGPITKQLQEFYFNAVRG-KIQRYKKWLTPV 308
gi 499172934 228 TLHDLYTADELFITGTAAEIVPVFEIDGRVINNKQVGEITKKLKEKFKDIRTKwGIKVYDE----- 288
gi 499180893 231 GLYDLYTADEVFVTGTAAEIAPIVVIDGRKIGDGKPGEITRKLMEEFSKLTESeGVPIYE------ 290
gi 3122274   242 TREMLYIADEAFFTGTAAEITPIRSVDGIEIGAGRRGPVTKLLQDEFFRIIRA-ETEDSFGWLTYI 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap