Conserved Protein Domain Family
ilvA_1Cterm

?
TIGR01127: ilvA_1Cterm 
threonine ammonia-lyase, medium form
A form of threonine dehydratase with two copies of the C-terminal domain pfam00585 is described by TIGR01124. This model describes a phylogenetically distinct form with a single copy of pfam00585. This form branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any pfam00585 domain. Many members of this model are found in species with other Ile biosynthetic enzymes. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 130197
View PSSM: TIGR01127
Aligned: 5 rows
Threshold Bit Score: 563.6
Threshold Setting Gi: 15643124
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10581515  106 TPLEYSHTFSDLTGADVRPKLECFQRTGSFKIRGATNRIRTLSADQQDAGVVTASAGNHAQGVALAASRSGVDSKVVMPE 185
gi 499203000  26 TPLIKSTTFGNEYGSEMYFKLENFQKTGSFKSRGALFKFSKLSEDDRRRGVLTASAGNHAQGVAYAAKVNGINAKIVMPE 105
gi 488947683  21 TPFIYSSFLSDICQSEIYLKNENLQITGAYKIRGAYNKIANLSTEQKQHGVIAASAGNHAQGVAISAKKFSIKAVIVMPE 100
gi 499168134  32 TPLDKSTTLSRITGAEVYLKLENLQKTGSFKVRGPLFKLGRALEKGSVEGVVAASAGNHAQGVAYAASFYGLKSVIVMPE 111
gi 490184544  21 TALAYSSVLSEVTGGEIYLKMENLQKTGSFKIRGAYNKIAHLSEEERKRGVVAASAGNHAQGVALAAQIFGIPATIVMPR 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10581515  186 SAPISKIKATKSYGAEVVLHGADYDDAQAHAHELEAAEGRTYVHAFDDEYIMAGQGTLGLEIAADCPTVDTVVVPIGGGG 265
gi 499203000 106 YTIPQKVNAVAGYGAEVILHGFDYDEAHRYADDLARKENRVFIEAFNDRWVISGQGTIGLEIMEDRPDIDTIIVPVGGGG 185
gi 488947683 101 STPLLKVSATKALGAEVILRGDNFDEAYAFATSYAKENNLSFIHPFEDEFVMAGQGTLMLEMLDEISDLDMIIAPVGGGG 180
gi 499168134 112 LAPPAKVKATRSYGAEVVLHGRVVDEAFKLAEKIAEERGYMLVHPFDDPEIMAGNGTIAWEAYEQGGKFDTVIVPVGGGG 191
gi 490184544 101 YAPLSKITKTRNLGAQVILEGNIFDEAYEAALRIQEKTGAVFVHPFNDPHVIAGQGTIGLEIMEDLPDVEVVVVPVGGGG 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10581515  266 LISGVATALKGELDDVRVIGVQAEGASTVARSLDKGQPQAVDHVDTIADGIAVRQVGAQTFPVIQEHVDEVVTVSDDEIA 345
gi 499203000 186 LISGIALAAKHHNPHVRIIGIESELSDSMKASLREGKIVAHTSGVSICDGISVKYPGDLTFNIAKDYVDDIVTVTEESVS 265
gi 488947683 181 LISGISSTAKQINPNIKIIGVGAKGAPAMYESFHAKKIKNAKSVRTIADGIAVRDANPINFNIILECVDDFIQVDDEEIA 260
gi 499168134 192 LISGVVSVVRKLMPGVKVIGVEAEAAPKFVESFKEGKPIEVEVTHSLADGLVTKKPGRLTYPIVKHLVDKVVAVDEHEIA 271
gi 490184544 181 LISGVSVAIKSMNPEVKVIGVQTENMPSMIASLRRGRAERVEGKPTLADGIAVKKPGDLTFELVKKYVDEMVAVNEEEIA 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10581515  346 TALVLLLERGKTLVEGAGATALAAVLEDKFEyADGETIVPALCGGNIDLNLLTTVIVRGLVDQGRYVKIRTVLKDSPGSL 425
gi 499203000 266 KAIYRLFERMKIVAEPSGAVGLAAIMEGKVD-VKGRKVAIVVSGGNINPLLMSKIIYKELENLGQLVRIECIIPDRPGNL 344
gi 488947683 261 NAVLFLLEKHKIIVEGAGAASVAALLHQKINtQNHKKIGVVLSGGNIDAQMLNIIIEKGLFKSYRKMQIYVTLVDKPGAL 340
gi 499168134 272 SAMYLLLERSKILAEGAGAAGVAALLARVVK-PKG-KTLVIVSGGNADLTSIEKVILVGLAREGRIARITGVIPDIPGQL 349
gi 490184544 261 DAILFLLEQAKVVAEGAGAVGVAAVLN-KLD-VKGKKVAIVISGGNIDVNMIDRIINKGLVKSGRKVFIETFVMDRPGAL 338
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 10581515  426 NDLLATAAEERANIYAIQHDRTNRDIAMNATEVELDLETRGPEHVDRLLTRIQDEGFDVTV 486
gi 499203000 345 YRIAEAIAKNGGNIYHAEVDNLRKETPPGFQSVIFSVNVRGQDHLDRILSTLREMGYIFKV 405
gi 488947683 341 LHLTDSLKIANANIVKIDYDRFSTKLDYGDAMISITLETKGKEHQEEIRKILTQKAFNFYE 401
gi 499168134 350 YKVLEVIAEKRCNVVDIIHDRLHPRISPGMARVTIVLEVPERMLLFELLEDLRDMGYKFVI 410
gi 490184544 339 KELLGIVAELGANVLSVFHNRSAKEVPIGFAKIELELETVDEKHVEEIERVLIAKGYEVRI 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap