1EYZ,2CZG


Conserved Protein Domain Family
purT

?
TIGR01142: purT 
Click on image for an interactive view with Cn3D
phosphoribosylglycinamide formyltransferase 2
This enzyme is an alternative to PurN (TIGR00639) [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 130212
View PSSM: TIGR01142
Aligned: 10 rows
Threshold Bit Score: 547.8
Threshold Setting Gi: 339630458
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EYZ_A        14 RVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDMLIQ 93
gi 172045945  13 KFLLLGSGELGKEVVIEAQRLGIECIAVDRYQNAPAMQVAHKSYVIDMKDYDALMAIIEREEPDYIVPEIEAINTDALID 92
gi 2500005    10 TFLLLGSGELGKEFTIAAQRLGNRVIAVDRYPDAPAMQVAQVAEVISMLDGNALEAVVKKYQPDWIVPEVEAIRTEKLLE 89
gi 487807539  14 RVLLLGSGELGKEVAIECQRLGLEVIACDRYADAPAMQVAHRSHVFDMLDADALQQVIDLEKPHFVVPEIEAIATSKLVE 93
gi 3915837     6 KVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVAHNSYVVDMLDPEQIRTIIEKENPDLIVPEVEAIATDELLK 85
gi 489183218  14 RVLLCGSGELGKEVAIELQRLGCEVIAVDRYGNAPAMQVAHRSHVISMLDGAALRAVIEQEKPHYIVPEIEAIATATLVE 93
gi 172045668  18 KILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFE 97
gi 499170483  18 KILLLGSGELGKEIAIEAQRLGVEVIAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFE 97
gi 503754665  27 RVMLLGSAEPSRELAIALQGLGAEVIAVDGYVGAPAHRIADQSVVVTMTDAEELTAVIRRLQPDFLVTVTAAVSVDALDA 106
2CZG_A        21 KILLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDALFE 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EYZ_A        94 LEEEG---LNVVPCARATKLTMNREGIRRLAAEELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRS 170
gi 172045945  93 AEKMG---YTVIPTAEATKITMNRELIRRLAAEKLGLKTAKYEFADSLEELRDAVEKLGLPCVVKPIMSSSGKGQSVVRS 169
gi 2500005    90 LEAGG---YRVIPTAQATNLTMNRDRIRELAAQQLGVRTARYNYATSLAELEEVSQAIGFPNVVKPVMSSSGKGQSVVNN 166
gi 487807539  94 LEAQG---LNVVPTANATRLTMNREGIRRLAAEELGLPTSAYQFADSYESFAAAVETIGLPCVCKPVMSSSGKGQSVIRT 170
gi 3915837    86 LEEEG---FHVIPNARAAKLTMDREGIRRLAAETLGLATAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRS 162
gi 489183218  94 LEAEG---YTVVPTARAAQLTMNREGIRRLAAEELGLPTSPYHFADTFEDYRRGVERVGYPCVVKPIMSSSGKGQSVLKG 170
gi 172045668  98 FEKDG---YFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHTKAIMSSSGKGSYFVKG 174
gi 499170483  98 FEKEG---YFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHTKAIMSSSGKGSYFVKG 174
gi 503754665 107 VEQADgecTELVPNARAVRCTADREGLRRLAADQLGLPTAPFWFVGSLGELQAVAVHAGFPLLVSPVAGVAGQGSSVVAG 186
2CZG_A       101 FEKDG---YFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATTLDELYEACEKIGYPCHTKAIMSSSGKGSYFVKG 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EYZ_A       171 AEQLAQAWKYA-----QQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDG-----VHFCAPVGHRQEDGDYRESWQPQQMS 240
gi 172045945 170 EEDIEKAWKIA-----KEGARGIGNRVIVEEFINFDYEITLLTARTAEG-----TKFCEPIGHVQIDGDYHESWQPHNMS 239
gi 2500005   167 AGEVQQAWSAA-----IAGARGDQTKVIVEEFIPFELEITLLTIRQWQGe----TLFCDPIGHRQERGDYQESWQPAPLT 237
gi 487807539 171 PEQIEAAWQYA-----QQGGRSGAGRVIVEGFVDFDYEITLLTVRAVDG-----VHFCAPIGHRQEDGDYRESWQPQVMS 240
gi 3915837   163 EADLESCWETA-----MEGGRVKNGRVIVEEFIPFESEITLLTVRAVNG-----TAFCEPIGHVQKDGDYIESWQPHDMT 232
gi 489183218 171 PDDLQAAWDYA-----QEGGRAGKGRVIVEGFIDFDYEITLLTVRHVDG-----TTFCAPIGHRQVKGDYHESWQPQAMS 240
gi 172045668 175 PEDIPKAWEEA-----KTKARGSAEKIIVEEHIDFDVEVTELAVRHFDEngeivTTFPKPVGHYQIDGDYHASWQPAEIS 249
gi 499170483 175 PEDIPKAWEEA-----KTKARGSAEKIIVEEHIDFDVEITELAVRHFDEngeivTTFPKPVGHYQIDGDYHASWQPAEIS 249
gi 503754665 187 PNEVEPAWQRAaghqvQPQTGGVSPRVCAESVVEIEFLVTMIVVCSQGPng-plIEFCAPIGHRDADAGELESWQPQKLS 265
2CZG_A       178 PEDIPKAWEEA-----KTKARGSAEKIIVEEHIDFDVEVTELAVRHFDEngeivTTFPKPVGHYQIDGDYHASWQPAEIS 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EYZ_A       241 PLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQ--DLSEFALHVRAFLGLPVGg---- 314
gi 172045945 240 AELKEQAQDIAKKVTDALGGYGIFGVELFVKGDEVIFSEVSPRPHDTGMVTMITQ--EMSEFEIHVRAILGLPVS----- 312
gi 2500005   238 QRQLAQAQAIAKTVTDALGGAGIFGVEFFITPEEVIFSELSPRPHDTGMVTLISQ--NLNEFELHLRAILGLPIPq---- 311
gi 487807539 241 ENAIKAAEYVAEQVVNALGGYGLFGVELFVKGDKVIFNEVSPRPHDTGMVTLISQ--ELSEFALHVRAFTGLPIGq---- 314
gi 3915837   233 EQQIEEAKHIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGLVTLVTQ--NLSEFALHVRAILGFPITe---- 306
gi 489183218 241 AQALAESERVARAVTEALGGRGLFGVELFVKGDQVWFSEVSPRPHDTGLVTLISQ--DLSEFALHARAILGLPIPv---- 314
gi 172045668 250 EKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHppGFSEFALHLRAVLGLPIPgewvd 329
gi 499170483 250 EKAEREVYRIAKRITDVLGGLGLFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHppGFSEFGLHLRAVLGLPIPgewvd 329
gi 503754665 266 TAALDAAKSIAARIVKALGGRGVFGVELMINGDEVYFADVTVCPAGSAWVTVRSQ--RLSVFELQARAILGLAVD----- 338
2CZG_A       253 EKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTGMVTLASHppGFSEFALHLRAVLGLPIPgewvd 332
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1EYZ_A       315 ----IRQYGPAASAVILPqlTSQNVTFD------N-VQNAVG-ADLQIRLFGKPEIDGSRRLGVALATAESVVDAIERAK 382
gi 172045945 313 ----TKLIHPGASHVIKA--EINKYAPK------YhIEDALKvPNTKLRLFGKPNAKVGRRMGVALAYADSVEKARELAE 380
gi 2500005   312 ----IKQTGPAASAVILAleAGEKLSYA------G-LAEALTeSGTDVRLFGKPNARPHRRLGVALAQAESVDAARRLAQ 380
gi 487807539 315 ----IVQYGPSASAAILGqgQSQNIQFN------G-LDDALSiPHTQVRLFGKPDIAGRRRLGVALSRGKTTQEATDRAI 383
gi 3915837   307 ----ITQLSPGASRPLKApeELADYTVE------G-LENALAvPKTQVRVFGKPITKAGRRMAVALSAADSVETARENAK 375
gi 489183218 315 ----IRQLGPSASAVILVegKSRQVAFA------N-LGAALSeADTALRLFGKPEVDGQRRMGVALARDESIDAARAKAT 383
gi 172045668 330 gyrlFPMLIPAATHVIKAkvSGYSPRFR------G-LVKALSvPNATVRLFGKPEAYVGRRLGIALAWDKDVEVAKRKAE 402
gi 499170483 330 gyrlFPMLIPAATHVIKAkvKGYSPRFR------G-LAKALSvPNATVRLFGKPEAYVGRRLGVVLAWDKDVQEAKKRAE 402
gi 503754665 339 ----TLMISPGAARVINPdhTAGRAAVGaappadA-LTGALGvPESDVVIFG-------RGLGVALATAPEVAIARERAR 406
2CZG_A       333 gyrlFPMLIPAATHVIKAkvSGYSPRFR------G-LVKALSvPNATVRLFGKPEAYVGRRLGIALAWDKDVEVAKRKAE 405

                 ....*....
1EYZ_A       383 HAAGQVKVQ 391
gi 172045945 381 KCAHAVRIE 389
gi 2500005   381 TVAEKVIVQ 389
gi 487807539 384 ECAKAVKIH 392
gi 3915837   376 KALDQLILK 384
gi 489183218 384 RAAQAVRVE 392
gi 172045668 403 MVAHMIELR 411
gi 499170483 403 MVAHMIELR 411
gi 503754665 407 EVASRLNVP 415
2CZG_A       406 MVAHMIELR 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap