Conserved Protein Domain Family
ATP_synt_b

?
TIGR01144: ATP_synt_b 
ATP synthase, F0 subunit b
This model describes the F1/F0 ATP synthase b subunit in bacteria only. Scoring just below the trusted cutoff are the N-terminal domains of Mycobacterial b/delta fusion proteins and a subunit from an archaeon, Methanosarcina barkeri, in which the ATP synthase homolog differs in architecture and is not experimentally confirmed. This model helps resolve b from the related b' subunit. Within the family is an example from a sodium-translocating rather than proton-translocating ATP synthase. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130214
View PSSM: TIGR01144
Aligned: 8 rows
Threshold Bit Score: 124.823
Threshold Setting Gi: 584815
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 114618    10 QAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQILDE 89
gi 114632    10 QAISFALFVWFCMKYVWPPLMKAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKRTATEIIEQANKRKSQILDE 89
gi 1168593   10 QLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNLVEQELSAAKLQAQDILDAANKRRNEVLDE 89
gi 22654218  10 QALSFILFVWFCMKYIWPPIIFAIETRQKNIEESLISLKKAEEELIIIQKKMNQIIQDSKEKASFIINEANKKKSIILED 89
gi 728929    13 QLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRATELVREAKDKAAEIIANAERRGVELREE 92
gi 45603     13 QIINFLILMFFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVKSAKTEANEMLLRAEKKADERKET 92
gi 1773262   16 VTGSFILLLLLVKKFAWSQLAAIFKTREEKIAKDIDDAENSRQNAQVLENKRQVELNQAKDEAAQIIDNAKETGKAQESK 95
gi 584815    20 QLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEKNKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEE 99
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 114618    90 AKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156
gi 114632    90 AREEAQAERQKILAQAEAELEAERNRARDDLRKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156
gi 1168593   90 VKAEAEELKAKIIAQGYAEVEAERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156
gi 22654218  90 AKSIALEESKKIFLRNQLEIDLKVMQVRKNLHKEIVDLSILIAEKIIKDNIQKDQYKYSIKKLIVSL 156
gi 728929    93 AQGKAREEADRIIASARAEIDVETNRAREVLRGQVVELVVNGTQRILHREIDDQTHRDIIDRMVGQL 159
gi 45603     93 ILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVTDLAVKLAEKMINEKVDAKIGANLLDQFIGEV 159
gi 1773262   96 IITEAHEEAGRLKDKANQDIATSKAEALSSVKADVADLSVLLAEKIMAKNLDKTAQGDLIDSYLDKL 162
gi 584815   100 IIQAARAESERLKEAARTEIVKEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEV 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap