Conserved Protein Domain Family
ATP_synt_delta

?
TIGR01145: ATP_synt_delta 
ATP synthase, F1 delta subunit
This model describes the ATP synthase delta subunit in bacteria, mitochondria, and chloroplasts. It is sometimes called OSCP for Oligomycin Sensitivity Conferring Protein. F1/F0-ATP synthase is a multisubunit, membrane associated enzyme found in bacteria and organelles of higher eukaryotes, namely, mitochondria and chloroplast. This enzyme is principally involved in the synthesis of ATP from ADP and inorganic phosphate by coupling the energy derived from the proton electrochemical gradient across the biological membrane. A brief description of this multisubunit enzyme complex: F1 and F0 represent two major clusters of subunits. Delta subunit belongs to the F1 cluster or sector and functionally implicated in the overall stability of the complex. Expression of truncated forms of this subunit results in low ATPase activity. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130215
View PSSM: TIGR01145
Aligned: 10 rows
Threshold Bit Score: 178.661
Threshold Setting Gi: 231601
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 584811    6 VSKRYASALFDIANESAQLNQVEEELIVVKQVFQNEKALNDVLNHPKVPAAKKKELIQNAFG-SLSQSVlNTIFLLIDRH 84
gi 114576   10 VAQPYAQALLSIAKSKSLTEEFGTDARTLLNLLTENQQLRNFIDNPFIAAENKKALIKQILSeASPYLR-NFLLLLVDKR 88
gi 2493038   6 IADAYAEALLELANSNKSLKETTNDMNIVSQFLANSSDLKKFLGNPLITRERKKNVLKDVLGeQISSVSlNFLMLLVNRG 85
gi 461569    7 IAKVYAEGLFEIANTKNSLAEINEQLNSIKSVLKQMPEFYYFLVNPLISQQIKKNTIKIVFNnNLDKITlNFLLILIERR 86
gi 114580    7 VARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKN-EQMAELLSG-ALAPETLAESFIAVCGeQLDENGqNLIRVMAENG 84
gi 114588    7 IARPYAKAAFDFALEKDQLDQWGQMLSFAAEVAKN-EQMNELLTG-SVSADKMAEIFVAVCGeQVDTHGqNLLKVMAENG 84
gi 1168586   7 IARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAED-ETVKAYLSS-SLSAQKLADTVISICGeQLDQYGqNLIRLMAENK 84
gi 4033371   7 IARPYAKAIFELAIENQSIEKWKKTLIFINEIIRS-KKIEKFLSG-SLSPSYLSSFFIFVAGdHIDKDArNLIKLLAENQ 84
gi 231601    6 VGRRYAEAIYEIAESNDNVKELYETLNGVMELYNTDKEFKTLVDHPLIKREDKKEFAKKIFG-ELEESSlNIIFYLIEKD 84
gi 80096     6 VANRYRYALFQLAEEKSILSQVVQEMELVKEVVNTTPEFLQLLSHPKVTTEKKRAFIENSFKdSLSETSlHTLLLLVENK 85
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 584811   85 RAAIVPELTDEFIKLANVARQTEDAIVYSVKPLTDAEMLPLSQVFAKKAGVASLRIRNEVQTDLIGGIKVRIGNRIYDGS 164
gi 114576   89 RIFFLPEILQQYLALLRQLNQTVLAEVTSAVALTEDQQQAVTEKVLALTKARQVELATKVDSDLIGGVIIKVGSQVIDSS 168
gi 2493038  86 RVAFLDKIAQKFLELSYKQDAIEIAKVTSSVALSAQQQKELAGKLKLITGAKKIKLALRVEPKLIGGFTVEIGSKLIDTS 165
gi 461569   87 RIIYFYDIVDQFILIWNKATNTSVVEIASVISLTEKQQQYLINKLKEITKANYIKLKLKIDPSLIGGLIIKFGSNLIDLS 166
gi 114580   85 RLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRLSR-KVKLNCKIDKSVMAGVIIRAGDMVIDGS 163
gi 114588   85 RLAALPDVCTEFYTLKKEHEKEIDVEVISATELSDEQLANIGSKLEKRLER-KVKLNCSVDETLLGGVIIRAGDLVIDDS 163
gi 1168586  85 RLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNATQIEKIAAAMEKRLAR-KVKLNCNVDNALIAGVIVRTEDFVIDGS 163
gi 4033371  85 RFKIFNNILRQFLKLETSYQGNTIIELISAYSLQEHEIIDIRCILQKIFLS-KIKFIYKIDHQILDGIIIKKADTVFDFS 163
gi 231601   85 RLSSIRGIVAEYLKIYYAKNQILDVEAIFAIEPTKDQKAKLIEQLEKKTGK-KVNLEVSIDKSIIAGGIIKIGDEIIDGS 163
gi 80096    86 RIESLVDMIDSFKEMSYEAQDMAEAVVYSAKPLTSEEQAQIAVIFAKKVNKAKLLVINVVNKDLLGGLKIRIGDRIYDGR 165
                      170
               ....*....|..
gi 584811  165 VSGKLQRIERQL 176
gi 114576  169 IRGQLRRLSLRL 180
gi 2493038 166 IRGQLKKISNLL 177
gi 461569  167 LKGKLKNSPYI- 177
gi 114580  164 VRGRLERLADVL 175
gi 114588  164 ARGRLNRLSDAL 175
gi 1168586 164 SRGQLTRLANEL 175
gi 4033371 164 VRSYLKQLSDVL 175
gi 231601  164 VRRQLDTIARS- 174
gi 80096   166 VKSQLDRLERQL 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap