Conserved Protein Domain Family
V_ATP_synt_G

?
TIGR01147: V_ATP_synt_G 
vacuolar ATP synthase, subunit G
This model describes the vacuolar ATP synthase G subunit in eukaryotes and includes members from diverse groups e.g., fungi, plants, parasites etc. V-ATPases are multi-subunit enzymes composed of two functional domains: A transmembrane Vo domain and a peripheral catalytic domain V1. The G subunit is one of the subunits of the catalytic domain. V-ATPases are responsible for the acidification of endosomes and lysosomes, which are part of the central vacuolar system. [Energy metabolism, ATP-proton motive force interconversion]
Statistics
?
PSSM-Id: 130217
View PSSM: TIGR01147
Aligned: 5 rows
Threshold Bit Score: 103.756
Threshold Setting Gi: 2493140
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2493140   1 MSAQKSaGIQLLLDAEREATKIVQKAREYRTKRVREARDEAKKEIEAYKAQKEAEFKKFEAEHTQGNQAAQEEANAEAEA 80
gi 3183198   1 MASQTQ-GIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREAEFKAFEQQYLGTKEDIESKIRRDTED 79
gi 2493139   1 MASQTH-GIQQLLAAEKRAAEKVSEARKRKAKRLKQAKEEAQDEVEKYRQERERQFKEFEAKHMGTREGVAAKIDAETRI 79
gi 3183197   1 MASQSQ-GIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEVEQYRLQREKEFKAKEAAALGSHGSCSTEVEKDTQE 79
gi 1353223   1 MSQKN--GIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQKNAGGVGELEKKAEAGVQG 78
                       90       100       110
               ....*....|....*....|....*....|....
gi 2493140  81 RIREIKEAGNKNREQVIKDLLHAVFTPSPEAMAA 114
gi 3183198  80 QISGMKQSVAGNKQAVIVRLLQLVCDIKPELHHN 113
gi 2493139  80 KIDEMNKMVQTQKEAVIKDVLNLVYDIKPELHIN 113
gi 3183197  80 KMTILQTYFQQNRDEVLDNLLAFVCDIRPEIHEN 113
gi 1353223  79 ELAEIKKIAEKKKDDVVKILIETVIKPSAEVHIN 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap