Conserved Protein Domain Family
mtrG

?
TIGR01149: mtrG 
N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G
This model describes N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit G in methanogenic archaea. This methyltranfersae is membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 130219
View PSSM: TIGR01149
Aligned: 5 rows
Threshold Bit Score: 98.6274
Threshold Setting Gi: 668978
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 668978    4 EEKttIPRVLVSADEFNKANEKLDEIEEKVEFTVGEYSQRIGQQIGRDIGILYGIVIGLIILAVTNILFAGL 75
gi 4691343   2 DGK--APAAFVEPGEFNEVMKRLDKIDEKIEFVNSEVAQKIGKKVGRDIGILYGGFIGLLLFLIYTVVSSMF 71
gi 20095233  2 DGK--APAAFVEPGEFNEVMKRLDQIDEKVEFVNSEVAQRIGKKVGRDIGILYGGVIGLLLFLIYVQISSMF 71
gi 2497852   4 DEK--LPQVIMDPADYEALKKRLDELEKKVENTNAELFQLAGKKVGRDIGILYGLVIGIILSYILPALIKII 73
gi 6093439   4 EES--VPKMVAPEDDIREIHSRLDEIERRLDFVWGEVYQRFGKRIGRDIGILYGLVIGLYLCMLYILLGVAF 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap