1IZL


Conserved Protein Domain Family
psbD

?
TIGR01152: psbD 
Click on image for an interactive view with Cn3D
Photosystem II, DII subunit (also called Q(A))
This model describes the Photosystem II, DII subunit (also called Q(A)) in bacterial and its equivalents in chloroplast of algae and higher plants. Photosystem II is in many ways functionally equivalent to bacterial reaction center. At the core of Photosystem II are several light harvesting cofactors including plastoquinones, pheophytins, phyloquinones etc. These cofactors are intimately associated with the polypeptides, which principally including subunits DI, DII, Cyt.b, Cyt.f and iron-sulphur protein. Together they participate in the electron transfer reactions that lead to the net production of the reducting equivalents in the form of NADPH, which are used for reduction of CO2 to carbohydrates(C6H1206). Phosystem II operates during oxygenic photosynthesis and principal electron donor is H2O. Although no high resolution X-ray structural data is presently available, recently a 3D structure of the supercomplex has been described by cryo-electron microscopy. Besides a huge body of literature exits that describes function using a variety of biochemical and biophysical techniques. [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130222
View PSSM: TIGR01152
Aligned: 21 rows
Threshold Bit Score: 686.25
Threshold Setting Gi: 400884
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IZL_D        1 MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST 80
gi 131290     1 MTIAIGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWYTHGLATSYLEGCNFLTAAVST 80
gi 400884     1 MTFTDLNTENKNGWFDVADDWLKKDRFIFIGWSGLLLFPCSYLALGGWLTGITFVTSWYTHGLASSFLEGCNALTAAVST 80
gi 1346849    1 MTVAIGRSDSERGWFDVLDDWLKRDRFVFLGWSGLLLLPCAYLAVGAWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVST 80
gi 131300     1 MTIAVGRAPVERGWFDVLDDWLKRDRFVFIGWSGLLLFPCAFMALGGWLTGTTFVTSWYTHGLASSYLEGANFLTVAVSS 80
gi 131298     1 MTIAVGRAPQERGWFDVLDDWLKRDRFVFVGWSGILLFPCAFMALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSS 80
gi 93141301   1 MTIAVGRAPAERGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYLALGGWLTGTSFVTSWYTHGIASSYLEGGNFLTVAVST 80
gi 1709835    1 MTTAVGRIS-DRGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYMAIGGWLTGTTFATSWYTHGIASSYLEGCNFLTVAIST 79
gi 1346851    1 MTIAIGQNQ-ERGLFDLIDDWLKKDRFVFIGWSGLLLFPTAYLAAGGWMTGTTFVTSWYTHGLASSYLEGCNFLTAAVST 79
gi 1709834    1 MTIAIGQEK-TRGGFDLVDDWLKRDRFVFVGWSGLLLFPCAYLAVGGWLTGTTFVTSWYTHGLASSYLEGCNFLTAAVST 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IZL_D       81 PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY 160
gi 131290    81 PANSMAHSLLFVWGPEAQGDFTRWCQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIY 160
gi 400884    81 PPNSMGHSLLLLLGSEAQWDFTRWLQIGGLWPFIALHGAFGLIGFMLRQFEIAKAVQIRPYNAIAFSAPISVFVSVFLIY 160
gi 1346849   81 PANSMGHSILFVWGPEAQGDFTRWCQIGGLWTFTALHGALGLIGFTLRQFEIARLIGLRPYNAIAFSGPIAVFVSVFLLY 160
gi 131300    81 PADAFGHSLLFLWGPEAQGNLTRWFQIGGLWPFVALHGAFGLIGFMLRQFEISRLVGIRPYNAIAFSGPIAVFVSVFLMY 160
gi 131298    81 PADSLGHSLLFLWGPEANWNFARWCQLGGLWSFVALHGAFGLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMY 160
gi 93141301  81 PADAFGHSLMLLWGPEAQGNFVRWCQLGGLWNFVALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSGPIAVFVSVFLMY 160
gi 1709835   80 PADSMGHALLLLWGPEAQGAFVRWVQLGGLWTFTALHGAFALIGFMLRQFEIARLVGVRPYNAIAFSAPIALFVSVFLIY 159
gi 1346851   80 PANSMGHSLLLLWGPEAQGDFTRWCQIGGLWAFIALHGAFGLIGFCLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLLY 159
gi 1709834   80 PANSMGHSLLFLWGPEAQGDFTRWCQIGGLWAFIALHGSFGLIGFCLRQFEIARLVGLRPYNAIAFSGPIAVFVSVFLMY 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IZL_D      161 PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA 240
gi 131290   161 PLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQA 240
gi 400884   161 PLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTIFEDGDSPNTFRAFNPLQS 240
gi 1346849  161 PLGQAGWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGSNTFPAFNPTQA 240
gi 131300   161 PLGQSSWFFAPSFGVAGIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEDSNTFRAFEPTQA 240
gi 131298   161 PLGQSSWFFAPSFGVAGIFRFILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSDQANTFRAFEPTQA 240
gi 93141301 161 PLGQSSWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSEQSNTFRAFEPTQA 240
gi 1709835  160 PLGQSSWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFEDGDDATTFRGFEPTQS 239
gi 1346851  160 PLGQASWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGDAANTFRAFTPTQS 239
gi 1709834  160 PLGQASWFFAPSLGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVQNTLFEDGDAADTFRAFTPTQS 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1IZL_D      241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL 320
gi 131290   241 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNIL 320
gi 400884   241 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMVFVPVTGLRMSALGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNIL 320
gi 1346849  241 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLGVNLRAYDFVSQEIRAAEDPEFETFYTKNLL 320
gi 131300   241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 320
gi 131298   241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNIL 320
gi 93141301 241 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 320
gi 1709835  240 EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWMSAIGVVGLALNLRSYDFVSQEIRAAEDPEFETFYTKNIL 319
gi 1346851  240 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAIGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 319
gi 1709834  240 EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAFGIVGLALNLRAYDFVSQELRAAEDPEFETFYTKNIL 319
                       330       340       350
                ....*....|....*....|....*....|..
1IZL_D      321 LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 352
gi 131290   321 LNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL 352
gi 400884   321 LNEGIRAWMAAQDQPHEQFIFPEEVLPRGNAL 352
gi 1346849  321 LNEGIRAWMAVQDQPHENFVFSEEVLPRGNAL 352
gi 131300   321 LNEGMRAWMAPQDQPHENFIFPEEVLPRGNAL 352
gi 131298   321 LNEGMRAWMAPQDQIHEQFVFPEEVLPRGNAL 352
gi 93141301 321 LNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL 352
gi 1709835  320 LNEGLRAWMAPQDQPHENFIFPEEVLPRGNAL 351
gi 1346851  320 LNEGIRAWMAAQDQPHENFVFPEEVLPRGNAL 351
gi 1709834  320 LNEGIRSWMAAQDQPHENFIFPEEVLPRGNAL 351
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap