1Q90


Conserved Protein Domain Family
cytb6/f_IV

?
TIGR01156: cytb6/f_IV 
Click on image for an interactive view with Cn3D
cytochrome b6/f complex subunit IV
This model describes the subunit IV of the cytochrome b6/f complex. The cyt b6/f complex is central to the functions of the oxygenic phosynthetic electron transport in cyanobacteria and its equivalents in algae and higher plants. Energetically, on the redox scale the cytb6/f complex is placed below the other components - Q(A); Q(B) of the photosystem II in the Z-scheme, along the pathway of the electron transport. The complex is made of the following subunits: cytochrome f; cytochrome b6; Rieske 2Fe-2S; and subunits IV; V; VI; VII. Subunit IV is one of the principal subunits for the binding of the redox prosthetic groups. Each monomer of the complex contains a molecule of chlorophyll a and beta-carotene. [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130224
View PSSM: TIGR01156
Aligned: 12 rows
Threshold Bit Score: 263.196
Threshold Setting Gi: 129866
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1Q90_D       1 MSVTKKPDLSDPVLKAKLAKGMGHNTYGEPAWPNDLLYMFPVVILGTFACVIGLSVLDPAAMGEPANPFATPLEILPEWY 80
gi 129863    1 MSVLKKPDLTDPVLLEKLAQNMGHNYYGEPAWPNDLLYTFPVVILGTLACVVGLAVLDPAMVGEPANPFATPLEILPEWY 80
gi 129867    1 MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWY 80
gi 129861    1 MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWY 80
gi 129864    1 MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWY 80
gi 129858    1 MGVTKKPDLSDPILRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPSMIGEPANPFATPLEILPEWY 80
gi 5880691   1 MSVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTLSCITGLAVLDPAAIGEPANPFATPLEILPEWY 80
gi 3024374   1 MAVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVIFGTFACVIGLSVLDPAAIGEPANPFATPLEILPEWY 80
gi 1346688   1 MSILKKPDLNDPELRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGSIACCGGLAVLDPALIGEPADPFSTPLEILPEWY 80
gi 6911899   1 MATQKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWY 80
gi 129866    1 MSIIKKPDLSDPDLRAKLAKGMGHNYYGEPAWPNDILYMFPICILGALGLIAGLAILDPAMIGEPADPFATPLEILPEWY 80
gi 2493960   1 MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDPALVGEPADPFATPLEILPEWY 80
                       90       100       110       120       130       140       150
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
1Q90_D      81 FYPVFQILRVVPNKLLGVLLMAAVPAGLITVPFIESINKFQNPYRRPIATILFLLGTLVAVWLGIGSTFPIDISLTLGL 159
gi 129863   81 LYPAFQILRVVPNKLLGILLQTAIPLGLMLVPFIENINKFQNPFRRPIAMAVFLFGTLVTLWMGVAATLPIDKFFTLGL 159
gi 129867   81 FFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGL 159
gi 129861   81 FFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIEKSLTLGL 159
gi 129864   81 FFPVFQILRTVPNKLLGVLLMASVPAGLLTVPFLENVNKFQNPFRRPVATTVFLVGTVVALWLGIGATLPIDKSLTLGL 159
gi 129858   81 FFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTVVALWLGIGAALPIDKSLTLGL 159
gi 5880691  81 FFPVFQLLRTVPNKLLGVLLMAAVPAGLLTVPFIESINKFQNPFRRPVATTVFLIGTVVAIWLGIGATLPIDISLTLGL 159
gi 3024374  81 FYPVFQILRVVPNKLLGVLLMAAVPAGLLTVPFIENINKFQNPFRRPVATTVFLIGTVAAIWLGIGAALPIDISLTLGL 159
gi 1346688  81 FFPVFQILRVIPNKLLGVVLMAAVPAGLIAVPFIENVNKFQNPFRRPVASAVFLFGTFVAIWLGIGATFPIDKSLTLGL 159
gi 6911899  81 LYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGL 159
gi 129866   81 LYPTFQILRILPNKLLGIAGMAAIPLGLMLVPFIESVNKFQNPFRRPIAMTVFLFGTAAALWLGAGATFPIDKSLTLGL 159
gi 2493960  81 LYPVFQILRIVPNKLLGIVLQSMIPLGLIAIPFIESVNKFQNPFRRPIATAVFLFGTVFTLYLGIGAALPIDKSLTLGL 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap