2RCR


Conserved Protein Domain Family
pufL

?
TIGR01157: pufL 
Click on image for an interactive view with Cn3D
photosynthetic reaction center L subunit
This model describes the photosynthetic reaction center L subunit in non-oxygenic photosynthetic bacteria. Reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in form of NADH. Ultimately the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is some organic acid and not water. Much of our current functional understanding of photosynthesis comes from the structural determination, spectroscopic studies and mutational analysis on the reaction center of Rhodobacter sphaeroides. [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]
Statistics
?
PSSM-Id: 130225
View PSSM: TIGR01157
Aligned: 7 rows
Threshold Bit Score: 374.908
Threshold Setting Gi: 6690736
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RCR_L        34 FGVATFFFAALGIILIAWSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALREVEICRKLGI 113
gi 152020     35 FGVTTIFFATLGFLLILWGAAMQGTWNPQLISIFPPPVENGLNVAALDKGGLWQVITVCATGAFCSWALREVEICRKLGI 114
gi 6690736    35 FGVATFFFAALGIILIAWSAELQGSWNPQLIFVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSWALREVEICRKLGI 114
gi 2529234    35 FGVTTVFFTLLGVALIVLAASHGPTWNPWEISIAPPDLSYGLGFAPLNEGGFWQFITICATGAFVSWALRQVEIARKLGM 114
gi 3551480     1 FGVTTAISAALGTMLIFAAALEGPTMNPWLIDIQPPAIEEGLSIMPLKEGGYWQWITVCALIAFSSWVMRQAEISRKLGM 80
gi 499709989  35 FGVTTLLFTVLGTALIVWGAALGPSWTFWQISINPPDVSYGLAMAPMAKGGLWQIITFSAIGAFVSWALREVEICRKLGI 114
gi 3551492    35 FGVTAVFCALMGTALIIWNTALGPTWNLWQISVNPPDAKYGLGFAPLAEGGIWQWVTIFATGAFCSWALREVEICRKLGI 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RCR_L       114 GYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGAL 193
gi 152020    115 GFHIPVAFSMAIFAYLTLVVIRPMMMGSWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPFHMLGISLFFTTAWALAMHGAL 194
gi 6690736   115 GYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGIWTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGAL 194
gi 2529234   115 GLHVPFAFSFAILAYVTLVVIRPVLMGAWGYGFPYGIFSHLDWVSNVGYQFLHFHYNPAHMIAISFFFTNALALAMHGGL 194
gi 3551480    81 TYHVPIAFATAVFAYFTLQVIRPVWMGAWGHAFPYGIWTHLDWVSYTGYLYGNFHFNPIHMLAITFFFTNCLALALHGGL 160
gi 499709989 115 GYHIPFAFGFAILAYVSLVVIRPVMMGAWGYGFPYGFMTHLDWVSNTGYQYANFHYNPAHMLGITLFFTTCLALALHGSL 194
gi 3551492   115 GYHVPFAFSFAIFAYLTLVVIRPVLMGSWSYGFPYGIFTHLDWVSNTGYQYGQFHWNPGHMIAITFFFTTCLALALHGGL 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2RCR_L       194 VLSAANPEKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMIITGTIWFDQ--WVDWWQWWVKLPW 271
gi 152020    195 VLSAANPVKGKTMRTPDHEDTYFRDLMGYSVGTLGIHRLGLLLALNAVFWSACCMLVSGTIYFDL--WSDWWYWWVNMPF 272
gi 6690736   195 VLSAANPEKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMIITGTIWFDQ--WVDWWQWWVKLPW 272
gi 2529234   195 ILSASNPGKGEVVKAAEHEDTFFRDVVGYSSGALAIHRIGLFLAISAAFWSAVCIVISGPFWTRG--WPEWWGWWLNLPV 272
gi 3551480   161 VLSAVNPSGDTEVKTPEYEDTYFRDFIGYSVGTLGIHRVGLFLALNAGFWSAICIVISGPIYAGS--WVDFWEFWREIPL 238
gi 499709989 195 ILSAANPGKGEVVKGPEHENTYFQDTIGYSVGTLGIHRVGLILALSAVVWSIICMILSGPIYTGS--WPDWWLWWQKLPF 272
gi 3551492   195 VLSAINPDRGEPVKSPEHENTVFRDLVGYSIGTIGIHRVGLFLALSAVFWSAVCMLISGPVLPEGgsWPEWWEWWRRIPI 274

                 .
2RCR_L       272 W 272
gi 152020    273 W 273
gi 6690736   273 W 273
gi 2529234   273 W 273
gi 3551480   239 W 239
gi 499709989 273 W 273
gi 3551492   275 W 275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap