Conserved Protein Domain Family
cbiO

?
TIGR01166: cbiO 
cobalt transport protein ATP-binding subunit
This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 130234
View PSSM: TIGR01166
Aligned: 6 rows
Threshold Bit Score: 304.731
Threshold Setting Gi: 2808786
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2808786    24 YEEGPDVLTGLDFAVREGRALALLGRNGSGKTTLMRLLSGGLKPHTGTLTLGGEPVAYDRKGLTRLRTTVQLVVQDPDDQ 103
gi 3128344    14 FPGGVKALDDLSLAVPQGESLAILGPNGAGKSTLLLHLNGTLRPQSGRVLLGGTATGHSRKDLTDWRRRVGLVLQDADDQ 93
gi 532694     14 FPDRPRVLDTVNLAIGRGTRLALLGANGSGKTTLLSCLAGSLKPTGGAVERDGAPIDWGRKGLREHRRHVQMVLQDPDDQ 93
gi 154435     11 YQNEP-VLKGLNMDFSLSPVTGLVGANGCGKSTLFMNLSGLLRPQKGAVLWQGKPLDYSKRGLLARRQQVATVFQDPEQQ 89
gi 499178232  15 YPDGTEALRGINFHAERGEVVALLGPNGAGKSTLFLHFNGILQPTSGKIMIDGEELDYSKSGLIKARQKVGIVFQNPDDQ 94
gi 499180694  43 cyGDAEVLKGVNFKAERGKVTVLMGRNGAGKTTLLKHLNGLLRPKSGKVIIDGRELKYDRKSLLEVRKRVFYVFQNPDDQ 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2808786   104 LFAASVGQDVSFGPLNLGLSDAEVRSRVGEALAALDISGLAERPTHLLSYGQRKRTAIAGAVAMRPRVLILDEPTAGLDP 183
gi 3128344    94 LFAATVFEDVSFGPLNLGLSEAEARARVEEALAALSISDLRDRPTHMLSGGQKRRVAIAGAVAMRPEVLLLDEPTAGLDL 173
gi 532694     94 LFSADVSQDVSFGPMNLGLEPDEVHARVREALTLLGADHLAERATHQLSYGERKRVATAGAVAMRPDVLMLDEPTAGLDP 173
gi 154435     90 IFYTDIDSDIAFSLRNLGGPEAEITRRVDEALTLVDAQHFRHQPIQCLSHGQKKRVAIAGALVLQARYLLLDEPTAGLDP 169
gi 499178232  95 LFAPRVDEDVAFGPLNMGLSEDEVEERVRDALQKVGMLGYESKPPHHFSGGEKKRVAIAGIIAMKPDIMVLDEPTSGLDP 174
gi 499180694 123 ILSPTVWQDVAFGPRNLGLKGERLERVVRNALEAVGLSGYEKRLCSTLSGGEKRRLAIASALAMNPDYCIMDEPSANVDG 202
                        170       180       190
                 ....*....|....*....|....*....|
gi 2808786   184 DGQERLLATLDGLRAGGTTVVMATHDVDLA 213
gi 3128344   174 AGTEQLLTLLHGLRAAGMTLVFSTHDVELA 203
gi 532694    174 LGVHQMRDALDRLTDAGTTIVMATHDVALA 203
gi 154435    170 AGRTQMIAIIRRIVAQGNHVIISSHDIDLI 199
gi 499178232 175 RGASQILRLLHNLNEEGMTIIISTHDVDLA 204
gi 499180694 203 EGLRMIAEIIRKLREEGKGVVVSTHDADLA 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap