Conserved Protein Domain Family
proV

?
TIGR01186: proV 
glycine betaine/L-proline transport ATP binding subunit
This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lactis functionally complements an E.coli proU mutant. The comlementing locus is similar to a opuA locus in B.sutlis. This clarifies the differences in nomenclature. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 130254
View PSSM: TIGR01186
Aligned: 5 rows
Threshold Bit Score: 576.419
Threshold Setting Gi: 47831
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130990     36 EKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSF 115
gi 47831      36 EKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSF 115
gi 7404427    12 K--GGKKAVNNVNLKIAKGEFICFIGPSGCGKTTTMKMINRLIEPSAGKIFIDGENIMDQDPVEL----RRKIGYVIQQI 85
gi 489321018  13 vykGGKKAVNSIDLDIAKGEFICFIGPSGCGKTTTMKMINRLIEPSSGRIFIDGENIMEQDPVEL----RRKIGYVIQQI 88
gi 489327412  13 KATGSTVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQLREVRRKKISMVFQKF 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130990    116 ALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGL-ENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSA 194
gi 47831     116 ALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGL-ENYRHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSA 194
gi 7404427    86 GLFPHMTIQQNISLVPKLLKWPEQQRKERARELLKLVDMgPEYVDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFGA 165
gi 489321018  89 GLFPHMTIQQNISLVPKLLKWPEEKRKERARELLKLVDMgPEYLDRYPHELSGGQQQRIGVLRALAAEPPLILMDEPFGA 168
gi 489327412  93 ALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGL-EGFEHQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSA 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130990    195 LDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVF 274
gi 47831     195 LDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVF 274
gi 7404427   166 LDPITRDSLQEEFKKLQKTLHKTIVFVTHDMDEAIKLADRIVILKAGEIVQVGTPDDILRNPADEFVEEFIGKERLIQSS 245
gi 489321018 169 LDPITRDSLQEEFKKLQRTLNKTIVFVTHDMDEAIKLADRIVILKAGEIVQVGTPDEILRNPANEFVEEFIGKERLIQSR 248
gi 489327412 172 LDPLIRKDMQDELLDLHDNVGKTIIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVL 251
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130990    275 --SAKDIARRTPNGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLDAALIDAPLAVDA 352
gi 47831     275 --SAKDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGVVSIDSLKAALSQAQGIEAALIDDPLVVDA 352
gi 7404427   246 spDVERVDQIMNTQPVTITADKTLSEAIQLMRQERVDSLLVVNDERVLQGYVDVEIIDQCRKKANLVSEVLHEDIYTVLG 325
gi 489321018 249 p-DIERVEQMMNRTPVTVSADKTLSQAIQLMREKRVDSLLVVDRQNVLKGYVDVEMIDQNRKKASIVGDVYRSDIYTVQK 327
gi 489327412 252 --TAGHIMKRAETVRI----DKGPRVALTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSLQDILNTEFTTVPE 325
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*..
gi 130990    353 QTPLSELLSHVGQAPCA-VPVVDEDQQYVGIISKGMLLRALD--REG 396
gi 47831     353 QTPLSELLSHVGQAPCA-VPVVDEEHQYVGIISKRMLLQALD--REG 396
gi 7404427   326 GTLLRDTVRKILKRGVKyVPVVDEDRRLIGIVTRASLVDIVYdsLWG 372
gi 489321018 328 GALLRDTVRKILKQGIKyVPVVDEQNHLAGIVTRASLVDIVYdsIWG 374
gi 489327412 326 NTYLTEIFDVVSDANIP-IAVVDEKQRMKGIVVRGALIGALAgnNEy 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap