Conserved Protein Domain Family
bchC

?
TIGR01202: bchC 
2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase
[Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 130269
View PSSM: TIGR01202
Aligned: 4 rows
Threshold Bit Score: 493.986
Threshold Setting Gi: 6690728
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6690728     2 RTTAVILSGPRDLGLQTIQLNEPAPGDIVVEITHSGISTGTEKLFYTGQMPPFPGMGYPLVPGYEAAGEVVEAAPDTGF- 80
gi 114856      2 ETQVVIMSGPKAISTGIAGLTDPGPGDLVVDIAYSGISTGTEKLFWLGTMPPFPGMGYPLVPGYESFGEVVQAAPDTGF- 80
gi 7416785     2 KTQAIVLEQPEHLVLRELELTPPTDEDLVVDIEYSGISTGTEKLLWSGRMPAFPGMGYPLVPGYESVGRVVQAGANAHH- 80
gi 499235549   5 KSKAIVFSGVNQIELREVTLKPVSSTDVLVETWWSSISTGTEKMALNGLIPSPP-FIFPFIPGYETVGRIVEAGDHVNQg 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6690728    81 RPGDRVFVPGSNCFAptdagPIRGLFGAATKRLVTPAHRAVRIDPALEAEG-ALLALAATARHALAG----LNHVLPDLI 155
gi 114856     81 RPGDHVFIPGANCFTg----GLRGLFGGASKRLVTAASRVCRLDPAIGPEG-ALLALAATARHALAG----FDNALPDLI 151
gi 7416785    81 KVGERVFVPGARCYG-----EVRGLFGGAASRVVVAGSRVCNVSDSLGEQA-VLLALAATAYHSVAGggkrTPIVPPDLI 154
gi 499235549  84 LIGKFAYVAGSFGYE-----DVNAAFGGASQFIVCPVESLTVLDGIANPQCgIALPLGATALHIVDLa---EVKNRKVLV 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6690728   156 VGHGTLGRLLARLTIAAGGEPPVVWETKAERRRHAEGYEVIDPATD------QRRDYRSIYDASGDPKLIDSLVMRLAKG 229
gi 114856    152 VGHGTLGRLLARLTLAAGGKPPMVWETNPARRTGAVGYEVLDPEAD------PRRDYKAIYDASGAPGLIDQLVGRLGKG 225
gi 7416785   155 VGHGVLGRLLARMTVVAGFPAPTVWETNPTRAQGATGYAVLHPDED------PRRDYRAIFDVSGDSAILDRLVERLAKG 228
gi 499235549 156 LGQGAVGILAAELAKRFGASLVAVTEPHQRRLDISTSDIKVNPEKQdvsvalAGHEFDVLIDSTGIMSAIETGLRFLKFH 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6690728   230 GEIVLAGFYTEPVAFTFVPAFMKEARLRIAAEWQPEDMVATRALIESGALSLANLITHTRPASE-AAEAYATGLSDPDCL 308
gi 114856    226 GELVLCGFYTVPVSFAFVPAFMKEMRLRIAAEWQPADLSATRALIESGALSLDGLITHRRPAAE-AAEAYQTAFEDPDCL 304
gi 7416785   229 GEIVLAGFYTEPLHFNFAPAFMREAQIRCAAEWQRPDLLAVKELAETGRLSLDGLITHHASPSD-AAAAYRTAFGDPDCL 307
gi 499235549 236 GKVIFGGYYQR-MNIDYSQAFNKELSFIAARQWAKGDLHRVRELIAAGKINAEKIFTHQCTVDDnLMEAYMQAFSDSDCL 314

                 ....*
gi 6690728   309 KMILD 313
gi 114856    305 KMILD 309
gi 7416785   308 KMVLD 312
gi 499235549 315 KMIIH 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap