3CH4


Conserved Protein Domain Family
Pmev_kin_anim

?
TIGR01223: Pmev_kin_anim 
Click on image for an interactive view with Cn3D
phosphomevalonate kinase, animal type
This enzyme is part of the mevalonate pathway, one of two alternative pathways for the biosynthesis of IPP. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found. One is this type, found in animals. The other is the ERG8 type, found in plants and fungi (TIGR01219) and in Gram-positive bacteria (TIGR01220). [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 130290
View PSSM: TIGR01223
Aligned: 3 rows
Threshold Bit Score: 168.72
Threshold Setting Gi: 1294782
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3CH4_B      13 VLLFSGKRKSGKDFVTEALQSRLGADVCaVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGF 92
gi 1294782  11 VLLFSGKRKSGKDFVTEALQSRLGADVCaVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGF 90
gi 8928269   4 IVLISGKRKCGKDYISERLQRRLGSRSC-IVRISEPIKSEWARKLQLDLDALLGDGPYKEKYRRDMIVWSDEVRAQDYGY 82
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3CH4_B      93 FCR-KIVEGIS---QPIWLVSDTRRVSDIQWFREAYG-AVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGD-F 166
gi 1294782  91 FCR-KIVEGIS---QPIWLVSDTRRVSDIQWFREAYG-AVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGD-F 164
gi 8928269  83 FCRvAMEEALSrqqTPYILVSDVRRKNDIRWFRETYGpERVITLRLTSRPETRSARGWTFTAGIDDVPSECDLDDLADgF 162
                      170       180
               ....*....|....*....|....*...
3CH4_B     167 DWVIENHgvEQRLEEQLENLIEFIRSRL 194
gi 1294782 165 DWVIENHgvEQRLEEQLENLIEFIRSRL 192
gi 8928269 163 DVVLAND--EELDQEAIDILLDRLQLQY 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap