1W27


Conserved Protein Domain Family
phe_am_lyase

?
TIGR01226: phe_am_lyase 
Click on image for an interactive view with Cn3D
phenylalanine ammonia-lyase
Members of this subfamily of MIO prosthetic group enzymes are phenylalanine ammonia-lyases. They are found, so far, in plants and fungi. From phenylalanine, this enzyme yields cinnaminic acid, a precursor of many important plant compounds. This protein shows extensive homology to histidine ammonia-lyase, the first enzyme of a histidine degradation pathway. Note that members of this family from plant species that synthesize taxol are actually phenylalanine aminomutase, and are covered by exception model TIGR04473.
Statistics
?
PSSM-Id: 130293
View PSSM: TIGR01226
Aligned: 7 rows
Threshold Bit Score: 993.924
Threshold Setting Gi: 4127289
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A      26 DPLYWGIAAEAMTGSHLDEVKKMVAEYR-KPVVKLGGETLTISQVAAISARdgsG----VTV-ELSEAAR--AGVKASSD 97
gi 3334285  19 DPLNWGMAAEALTGSHLDEVKRMVAEFR-KPMVQLGGETLTVSQVAAIAAG---S----VKV-ELAESAR--AGVKASSD 87
gi 1709564  30 DPLNWVRAAKAMEGSHFEEVKAMVDSYFgAKEISIEGKSLTISDVAAVARRs--Q----VKV-KLDAAAAk-SRVEESSN 101
gi 129592   34 KTAGAGSLLPTTETTQLDIVERILADAGaTDQIKLDGYTLTLGDVVGAARR---G----RSV-KVADSPHirEKIDASVE 105
gi 871494   23 DPLNWGKATEEMTGSQVDEVKRIGAEYR-QPLVKIEGASLRIAQVAAVAAA---G----EARvELDESAR--ERVKASSD 92
gi 295824   11 DPLNWGAAAAEMAGSHLDEVKRMVAQFR-EPLVKIQGATLRVGQVAAVAQA---KdaarVAV-ELDEEAR--PRVKASSE 83
gi 4127289  36 LSKASRTMTKTSALSQFLEAYRELEGYKnGRAIKVDGQTLSIAAVAAAARY---N----AAV-ELDESPLvkERVRKSQL 107
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A      98 WVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG----------SDN--TLPHSATRAAMLVRIN 165
gi 3334285  88 WVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG----------NDSsnILPHSATRAAMLVRIN 157
gi 1709564 102 WVLTQMTKGTDTYGVTTGFGATSHRRTNQGAELQKELIRFLNAGVLGKC----------PEN--VLSEDTTRAAMLVRTN 169
gi 129592  106 FLRTQLDN--SVYGVTTGFGGSADTRTEDAISLQKALLEHQLCGVLPTSmdgf---algRGLenSLPLEVVRGAMTIRVN 180
gi 871494   93 WVMNSMMNGTDSYGVTTGFGATSHRRTKEGGALQRELIRFLNAGAFGTG----------TDGh-VLPAEATRAAMLVRIN 161
gi 295824   84 WILTCIAHGGDIYGVTTGFGGTSHRRTKDGPALQVELLRYLNAGIFGTG----------SDGh-TLPSETVRAAMLVRIN 152
gi 4127289 108 AIANKVSTGASVYGLSTGFGGSADTRTDKPMLLGFALLQHQHVGILPTStepldvlplqDANntSMPEAWIRGAILIRMN 187
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A     166 TLLQGYSGIRFEILEAITKFLNQNITPCLPLRGTITX--DLVPLSYIAGLLTGRPNSKAVGPTG-----VILSPEEAFKL 238
gi 3334285 158 TLLQGYSGIRFEILEAITKFLNQNITPCLPLRGTITAsgDLVPLSYIAGLLTGRPNSKAVGPTG-----ENLTAAEAFKL 232
gi 1709564 170 TLLQGYSGVRWDILETVEKLLNAWLTPKLPLRGTITAsgDLVPLSYIAGLLTGRPNSRVRSRDG-----IEMSGAEALKK 244
gi 129592  181 SLTRGHSAVRIVVLEALTNFLNHGITPIVPLRGTISAsgDLSPLSYIAASITGHPDSKVHVDG------KIMSAQEAIAL 254
gi 871494  162 TLLQGYSGIRFEILEAIAKLLNANVTPCLPLRGTITAsgDLVPLSYIAGLVTGRENAWALPPDG-----SKVNAAEGLKI 236
gi 295824  153 TLLQGYSGIRFEILEAITKLLNTGVTPCLPLRGTITAsgDLVPLSYIAGLITGRPNAQAISPDG-----RKVDAAEAFKL 227
gi 4127289 188 SLIRGHSGIRWELIEKMRELLAANVIPVVPLRGSISSsgDLSPLSYIAGTIIGNPSIKVYHGPSksgirQIGSSKDVLAL 267
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A     239 AGVEGg-FfELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPE-FTDHLTHKLKHHPGQIEAA 316
gi 3334285 233 AGVDGgfF-ELQPKEGLALVNGTAVGSGMASMVLFETNILAVLAEVMSAIFAEVMQGKPE-FTDHLTHKLKHHPGQIEAA 310
gi 1709564 245 VGLEKp-F-ELQPKEGLAIVNGTSVGAALASIVCFDANVLALLSEVISAMFCEVMNGKPE-FTDPLTHKLKHHPGQMEAA 321
gi 129592  255 KGLQP--V-VLGPKEGLGLVNGTAVSASMATLALTDAHVLSLLAQALTALTVEAMVGHAGsFHPFLHDVTRPHPTQIEVA 331
gi 871494  237 AGIQGg-FfELQPKEGLAMVNGTAVGSGLASTVLFEANILAILAEVLSAVFCEVMNGKPE-YTDHLTHKLKHHPGQIEAA 314
gi 295824  228 AGIEGg-FfTLNPKEGLAIVNGTSVGSALAATVMFDANILAVLSEVLSAVFCEVMNGKPE-YTDHLTHKLKHHPGSIDAA 305
gi 4127289 268 HNIEP--F-PLESKEPLGILNGTAFSASVAALALNEAIHLVLLAQVCTAMGTEALIGTRAsHAPFIHATARPHPGQVECA 344
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A     317 AIMEHILDGSAYVKAAQKLHEMDPLQ-KPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREIN--SVNDNPLIDVSRNKAI 393
gi 3334285 311 AIMEHILDGSSYVKAAEKQHEMDPLQ-KPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREIN--SVNDNPLIDVSRNKAI 387
gi 1709564 322 AIMEYVLDGSSYMKHAAKLHEMNPLQ-KPKQDRYGLRTSPQWLGPQVEIIRSATHMIEREIN--SVNDNPVIDVARDKAL 398
gi 129592  332 RNIRTLLEGSKYAVHHETEVKVKDDEgILRQDRYPLRCSPQWLGPLVSDMIHAHAVLSLEAGq-STTDNPLIDLENKMTH 410
gi 871494  315 AIMKHILEGSSYMKHAKKLGELDPLM-KPKQDRYALRTSPQWLGPQIEVIRAATKSIEREIN--SVNDNPLIDVSRGKAL 391
gi 295824  306 AIMEHILAGSSFMSHAKKVNEMDPLL-KPKQDRYALRTSPQWLGPQIQVIRAATKSIEREVN--SVNDNPVIDVHRGKAL 382
gi 4127289 345 ENIWNLLDGSKLAQLEEHEVRLEDDKyTLRQDRYPLRTSPQFLGPQIEDIISAFQTVTQECNylPATDNPLIDGETGESH 424
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A     394 HGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGrNPSLDYGFKGAEIAMASYCSELqflaNP 473
gi 3334285 388 HGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGrNPSLDYGFKGAEIAMASYCSELqflgNP 467
gi 1709564 399 HGGNFQGTPIGVSMDNLRLSISAIGKLMFAQFSELVNDYYNGGLPSNLSGGpNPSLDYGLKGAEIAMASYTSELlylaNP 478
gi 129592  411 HGGAFMASSVGNTMEKTRLAVALMGKVSFTQLTEMLNAGMNRALPSCLAAE-DPSLSYHCKGLDIAAAAYTSELghlaNP 489
gi 871494  392 HGGNFQGTPIGLSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGrNPSLDYGFKGAEIAMASYCSELqflgNP 471
gi 295824  383 HGGNFQGTPIGVSMDNARLAIANIGKLMFAQFSELVNEFYNNGLTSNLAGSrNPSLDYGFKGTEIAMASYSSELqylaNP 462
gi 4127289 425 HGGNFQAMAVTNAMEKTRLALHHVGKLLFSQSTELVNPAMNRGLPPSVAAT-DPSLNYHAKGLDIATAAYVAEA----TP 499
                      490       500       510       520       530       540       550       560
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A     474 VTNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLEENLKSTVKNTVSSVAKRVLTMGVNGE 553
gi 3334285 468 VTNHVQSAEQHNQDVNSLGLISSRKTAEAVEILKLMSTTFLVGLCQAVDLRHLEENLKSTVKNTVSQVAKKVLTMGVNGE 547
gi 1709564 479 VTSHVQSAEQHNQDVNSLGLVSARKSAEAIDILKLMLSTYLTALCQAVDLRHLEENMLATVKQIVSQVAKKTLSTGLNGE 558
gi 129592  490 VSTHVQPAEMGNQAINSLALISARRTAEANDVLSLLLATHLYCVLQAVDLRAMEFEHTKAFEPMVTELLKQHFGALATAE 569
gi 871494  472 VTNHVQSAEQHNQDVNSLGLISSRKTAEAIDILKLMSSTFLIALCQAVDLRHIEENVKSAVKSCVMTVAKKTLSTNSTGD 551
gi 295824  463 ITNHVQSAEQHNQDVNSLGLVSARKTLEAVDILKLMTSTYIVALCQAVDLRHLEENIKSSVKNCVTQVAKKVLTMNPTGD 542
gi 4127289 500 GPTHIQSAEMHNQAVNSLALISARATITSLEVLTSLIASYLYILCQALDLRALQREFLPGLDIIIREELRSSFGSFLSSE 579
                      570       580       590       600       610       620       630       640
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A     554 LHPSRFCEKD--LLRVVDREYIFAYIDDPCSATYPLMQKLRQTLVEHALKNGDNER-N-LsTSIFQKIATFEDELKALLP 629
gi 3334285 548 LHPSRFCELD--LLRVVDREYIFAYIDDPCSATYPLMQKLRQVLVEHALKNGETEK-NlS-TSIFQKIAAFEDELKALLP 623
gi 1709564 559 LLPGRFCEKD--LLQVVDNEHVFSYIDDPCNASYPLTQKLRNILVEHAFKNAEGEK-DpN-TSIFNKIPVFEAELKAQLE 634
gi 129592  570 VEDKVRKSIY----KRLQQNNSYDLEQRWHDTFSVATGAVVEALAGQEVS-----------LASLNAWKVACAEKAIALT 634
gi 871494  552 LHVARFCEKD--LLKEIDREGVFAYGDDPCSHNYPLMKKLRNVLVERALANAGRVQrR-H-LGVRQGR-AVRGGLRATLP 626
gi 295824  543 LSSARFSEKN--LLTAIDREAVFSYADDPCSANYPLMQKLRAVLVEHALTSGDRRA-R-G-LRVLQDHQV-RGGAPLCAA 616
gi 4127289 580 QMEKLQQNLTsaFEDHLDKTTTMDNTDRMTTMAATSSSVLLQFFTDSGASVPPSSC-D-L-LSSVSSFQSSVATRSSVLM 656
                      650       660       670       680       690       700       710       720
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W27_A     630 KEVESARAALESGNPAIPNRIEecRSYPLYKFVRKELGTEYLTGEKVT-----------SPGEEFEKVFIAMSKGEIIDP 698
gi 3334285 624 KEVESARAVVESGNPAIPNRIKecRSYPLYKFIREELGTVYLTGEKVT-----------SPGEEFDKVFTAMSKGEIIDP 692
gi 1709564 635 PQVSLARESYDKGTSPLPDRIQecRSYPLYEFVRNQLGTKLLSGTRTI-----------SPGEVIEVVYDAISEDKVIVP 703
gi 129592  635 RSVRDSFWAAPSSSSPALKYLSp-RTRVLYSFVREEVGVKARRGDVYlgk------qevTIGTNVSRIYEAIKSGCIAPV 707
gi 871494  627 GAIDGRAAVEN-GTAAIPSRITecRSYPLYRFVREELGTKYLTGEKTR-----------SPGEELNKVLVAINEGKHIDP 694
gi 295824  617 PGDRGRPRRRRQRTAPVANRIVesRSFPLYRFVREELGCVFLTGEKLK-----------SPGEECNKVFLGISQGKLIDP 685
gi 4127289 657 DDLRKEYIFGDRGPTPASQYIG--KTRPVYQFIRTTIGVRKHGSENYNkfynglgvedvTIGQNISRIYESIRDGKMQSI 734

               ....*.
1W27_A     699 LLECLE 704
gi 3334285 693 LLACLE 698
gi 1709564 704 LFKCLD 709
gi 129592  708 LVKMMA 713
gi 871494  695 LLECLK 700
gi 295824  686 MLDCLK 691
gi 4127289 735 IVSLFD 740
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap