3KAO


Conserved Protein Domain Family
lacD

?
TIGR01232: lacD 
Click on image for an interactive view with Cn3D
tagatose 1,6-diphosphate aldolase
This family consists of Gram-positive proteins. Tagatose 1,6-diphosphate aldolase is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130299
View PSSM: TIGR01232
Aligned: 3 rows
Threshold Bit Score: 689.866
Threshold Setting Gi: 125924
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3KAO_A      5 SKSNQKIASIEQLSNNEGIISALAFDQRGALKRXXAKHQTEEPTVAQIEQLKVLVAEELTQYASSILLDPEYGLPASDAR 84
gi 125924   2 VLTEQKRKSLEKLSDKNGFISALAFDQRGALKRLMAQYQDTEPTVAQMEELKVLVADELTKYASSMLLDPEYGLPATKAL 81
gi 125925   2 SKSNQKIASIEQLSNNEGIISALAFDQRGALKRMMAKHQTEEPTVAQIEQLKVLVAEELTQYASSILLDPEYGLPASDAR 81
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3KAO_A     85 NKDCGLLLAYEKTGYDVNAKGRLPDCLVEWSAKRLKEQGANAVKFLLYYDVDDAEEINIQKKAYIERIGSECVAEDIPFF 164
gi 125924  82 DKEAGLLLAFEKTGYDTSSTKRLPDCLDVWSAKRIKEQGADAVKFLLYYDVDSSDELNQQKQAYIERVGSECVAEDIPFF 161
gi 125925  82 NKDCGLLLAYEKTGYDVNAKGRLPDCLVEWSAKRLKEQGANAVKFLLYYDVDDAEEINIQKKAYIERIGSECVAEDIPFF 161
                     170       180       190       200       210       220       230       240
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3KAO_A    165 LEVLTYDDNIPDNGSVEFAKVKPRKVNEAXKLFSEPRFNVDVLKVEVPVNXKYVEGFAEGEVVYTKEEAAQHFKDQDAAT 244
gi 125924 162 LEILAYDEEISDAGSVEYAKVKPRKVIEAMKVFSDPRFNIDVLKVEVPVNVKYVEGFADGEVVYSKAEAADFFKAQEEAT 241
gi 125925 162 LEVLTYDDNIPDNGSVEFAKVKPRKVNEAMKLFSEPRFNVDVLKVEVPVNMKYVEGFAEGEVVYTKEEAAQHFKDQDAAT 241
                     250       260       270       280       290       300       310       320
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3KAO_A    245 HLPYIYLSAGVSAELFQETLKFAHEAGAKFNGVLCGRATWSGAVQVYIEQGEDAAREWLRTTGFKNIDDLNKVLKDTATS 324
gi 125924 242 NLPYIYLSAGVSAKLFQETLQFAHDSGAKFNGVLCGRATWAGSVEPYIKEGEKAAREWLRTTGFENIDELNKVLVKTASP 321
gi 125925 242 HLPYIYLSAGVSAELFQETLKFAHEAGAKFNGVLCGRATWSGAVQVYIEQGEDAAREWLRTTGFKNIDDLNKVLKDTATS 321

              ....*
3KAO_A    325 WKQRK 329
gi 125924 322 WTDKV 326
gi 125925 322 WKQRK 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap