Conserved Protein Domain Family
L-ribulokinase

?
TIGR01234: L-ribulokinase 
ribulokinase
This enzyme catalyzes the second step in arabinose catabolism. The most closely related protein subfamily outside the scope of this model includes ribitol kinase from E. coli. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 130301
View PSSM: TIGR01234
Aligned: 3 rows
Threshold Bit Score: 880.798
Threshold Setting Gi: 16128057
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498150     2 AYTIGVDFGTLSGRAVLVHVQTGEELAAAVKEYRHAVIDTVLP-KTGQKLPRDWALQHPADYLEVLETTIPSLLEQTGVD 80
gi 7242884     8 KYVIGVDFGTLSGRALVVRVADGAEMGSAEHTYRHGVVTEALPgHPEVRLPADYALQVPADYIDVLRFAIPEAVANAGID 87
gi 693229201   2 AIAIGLDFGSDSVRALAVDCATGEEIATSVEWYPRWQKGQFCD----A--PNNQFRHHPRDYIESMEAALKTVLAELSVE 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498150    81 P-KDIIGIGIDFTACTILPIDSSGQPLCMLPEYEEEPHSYVKLWKHHAAQKHADRLNQIAEEEGEAFLQRYG-GKISSEW 158
gi 7242884    88 P-ADVVGLGTDFTACTMVAATSDGTPLCQLDEFADRPHAYAKLWRHHAAQPQADRINALAAARGETWLPRYG-GLISSEW 165
gi 693229201  76 QrAAVVGIGVDSTGSTPAPIDADGNVLALRPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIgGIYSSEW 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498150   159 MIPKVMQIAEEAPHIYEAADRIIEAADWIVYQLCG-----SLKRSNCTAGYKAMWSEKAg-YPSDDFFEKLNPSMKTITK 232
gi 7242884   166 EFAKGLQILEEDPEIYAAIDRWVEGADWIVWQLTG-----RYVRNISTAGYKAIRQDGK--YPSRAFLAELNPGFASFVE 238
gi 693229201 156 FWAKILHVTRQDSAVAQSAASWIELCDWVPALLSGttrpqDIRRGRCSAGHKSLWHESWggLPPASFFDELDPILNRHLP 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498150   233 DKLSGSIHSVGEKAGSLTEKMAKLTGLLPGTAVAVANVDAHVSVPAVGITEPGKMLMIMGTSTCHVLLGEEV----HIVP 308
gi 7242884   239 DKIEQPIGRLGEAAGTLTAQAAAWTGLPEGIVVAVGNIDAHVTAAAADAADPGRLIAIMGTSTCHVMNGRFL----REVP 314
gi 693229201 236 SPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVGAG-AQPNALVKVIGTSTCDILIADKQsvgeRAVK 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498150   309 GMCGVVDNGILPGYAGYEAGQSCVGDHFDWFVKTC---------VPPAYQEEAKEKNIGVHELLSEKANHQAPGESGLLA 379
gi 7242884   315 GMCGVVDGGITDGLWGYEAGQSGVGDIFAWFTKNC---------VPKEIAIEASRRGLTLHEHLSELAAEQEVGEHGLVA 385
gi 693229201 315 GICGQVDGSVVPGFIGLEAGQSAFGDIYAWFGRVLgwpleqlaaQHPELKTQINASQKQLLPALTEAWAKNPSLDHLPVV 394
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498150   380 LDWWNGNRSTLVDADLTGMLLGMTLLTKPEEIYRALVEATAYGTRMIIETFKESGVPIEELFAAGGIaEKNPFVMQIYAD 459
gi 7242884   386 LDWHSGNRSVLVDHHLSGIMVGQTLDTTCVDQYRALLEATAFGTRMIVETFQRSGVPVEELVVAGGL-IKNPLLMQIYAD 464
gi 693229201 395 LDWFNGRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMALGGIaRKNQVIMQACCD 474
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2498150   460 VTNMDIKISGSPQAPALGSAIFGALAAGkekgGYDDIKKAAANMGKLKDITYTPNAENAAVYEKLYAEYKELVHYFGK-E 538
gi 7242884   465 VTGLPLSCVTSTQAPALGAAIHAAAAAG----EYRDVPTASARMGGRTKNAFTPIPENVTRYNALYAAYVELHDWFGR-N 539
gi 693229201 475 VLNRPLQIVASDQCCALGAAIFAAVAAK----VHADIPSAQQKMASAVEKTLQPCSEQAQRFEQLYRRYQQWAMSAEQhY 550

                 ...
gi 2498150   539 NHV 541
gi 7242884   540 NPL 542
gi 693229201 551 LPT 553
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap