2QF7


Conserved Protein Domain Family
pyruv_carbox

?
TIGR01235: pyruv_carbox 
Click on image for an interactive view with Cn3D
pyruvate carboxylase
This enzyme plays a role in gluconeogensis but not glycolysis. [Energy metabolism, Glycolysis/gluconeogenesis]
Statistics
?
PSSM-Id: 130302
View PSSM: TIGR01235
Aligned: 5 rows
Threshold Bit Score: 2097.16
Threshold Setting Gi: 1709946
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A         16 KILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLALHRFKADESYQVGRGphlardLGPIESYLSIDEVIRVAKLSGAD 95
gi 1709946     21 KILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVg----qYTPVGAYLAIDEIISIAQKHQVD 96
gi 1256798      5 KILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLALHRFKADESYQVGRGphlardLGPIESYLSIDEVIRVAKLSGAD 84
gi 489337568    8 KVLVANRGEIAIRIFRACTELNIRTVAVYSKEDSGSYHRYKADEAYLVGEG------KKPIDAYLDIEGIIDIAKRNKVD 81
gi 550486      40 SVLVANRGEIAIRVFRACNELGIRSVAVYSEQDKMHMHRQKADESYMVGKG------LAPVEAYLSIPEIIRVCKENDVD 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A         96 AIHPGYGLLSESPEFVDACNKAGIIFIGPKADTMRQLGNKVAARNLAISVGVPVVPATEPLPDDMAEVAKMAAAIGYPVM 175
gi 1709946     97 FIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVI 176
gi 1256798     85 AIHPGYGLLSESPEFVDACNKAGIIFIGPKADTMRQLGNKVAARNLAISVGVPVVPATEPLPDDMAEVAKMAAAIGYPVM 164
gi 489337568   82 AIHPGYGFLSENIHFARRCEEEGIVFIGPKSEHLDMFGDKVKAREQAEKAGIPVIPGSDGPAETLEAVEQFGQANGYPII 161
gi 550486     114 AVHPGYGFLSERSDFAQAVIDAGLRFIGPSPKVVQQMGDKVAARKAAIEAGVPIVPGTDGPVTTKEEALDFCKKHGLPVI 193
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        176 LKASWGGGGRGMRVIRSEADLAKEVTEAKREAMAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSVQRRNQ 255
gi 1709946    177 IKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQ 256
gi 1256798    165 LKASWGGGGRGMRVIRSEADLAKEVTEAKREAMAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHLFERDCSVQRRNQ 244
gi 489337568  162 IKASLGGGGRGMRIVRSESEVKEAYERAKSEAKAAFGNDEVYVEKLIENPKHIEVQVIGDKQGNVVHLFERDCSVQRRHQ 241
gi 550486     194 FKAAYGGGGRGMRVVRKMEEVEDNFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQ 273
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        256 KVVERAPAPYLSEAQRQELAAYSLKIAGATNYIGAGTVEYLMDADtG-KFYFIEVNPRIQVEHTVTEVVTGIDIVKAQIH 334
gi 1709946    257 KVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQ-N-RHYFIEINPRIQVEHTITEEITGIDIVAAQIQ 334
gi 1256798    245 KVVERAPAPYLSEAQRQELAAYSLKIAGATNYIGAGTVEYLMDAD-TgKFYFIEVNPRIQVEHTVTEVVTGIDIVKAQIH 323
gi 489337568  242 KVIEVAPSVSLSPELRDQICEAAVALAKNVNYINAGTVEFLVANN---EFYFIEVNPRVQVEHTITEMITGVDIVQTQIL 318
gi 550486     274 KVVEIAPAPRLPREVRDKMTEYAVKLAKHVGYENAGTVEFLCDES-G-NFYFIEVNARLQVEHTVTEEITGIDLVQSQIR 351
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        335 ILDGAAIGtpQSGVPnQEDIRLNGHALQCRVTTEDPEHNFIPDYGRITAYRSASGFGIRLDGGTSYSGAIITRYYDPLLV 414
gi 1709946    335 IAAGASLP--QLGLF-QDKITTRGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLV 411
gi 1256798    324 ILDGAAIGtpQSGVPnQEDIRLNGHALQCRVTTEDPEHNFIPDYGRITAYRSASGFGIRLDGGTSYSGAIITRYYDPLLV 403
gi 489337568  319 VAQGHSLHskKVNIPeQKDIFTIGYAIQSRVTTEDPQNDFMPDTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLV 398
gi 550486     352 VAEGMTLP--ELGYN-QENIKTQGYAIQCRVTTEDPANDFQPSTGRLEVFRSGEGMGIRLDSASAYAGAIISPYYDSLLV 428
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        415 KVTAWAPNPLEAISRMDRALREFRIRGVATNLTFLEAIIGHPKFRDNSYTTRFIDTTPELFQQVKRQDRATKLLTYLADV 494
gi 1709946    412 KCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKLLHYLADV 491
gi 1256798    404 KVTAWAPNPLEAISRMDRALREFRIRGVATNLTFLEAIIGHPKFRDNSYTTRFIDTTPELFQQVKRQDRATKLLTYLADV 483
gi 489337568  399 KLSTWALTFEQAAAKMVRNLQEFRIRGIKTNIPFLENVAKHEKFLTGQYDTSFIDTTPELFNFPKQKDRGTKMLTYIGNV 478
gi 550486     429 KVISHASDLQSSAAKMNRALREFRIRGVKTNIPFLLNVLENQKFLNGVLDTYFIDEHPQLFRFAKSKNRAQKLLNYLGEV 508
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        495 TVNG-HPEAKDRPKPLENAARPVVPYANGNGV--------------KDGTKQLLDTLGPKKFGEWMRNEKRVLLTDTTMR 559
gi 1709946    492 AVNGsSIKGQIGLPKLKSNPSVPHLHDAQGNVinvt------ksapPSGWRQVLLEKGPAEFARQVRQFNGTLLMDTTWR 565
gi 1256798    484 TVNG-HPEAKDRPKPLENAARPVVPYANGNGV--------------KDGTKQLLDTLGPKKFGEWMRNEKRVLLTDTTMR 548
gi 489337568  479 TVNG-FPGIGKKEKPAFDKPLGVKVDVDQQP---------------ARGTKQILDEKGAEGLANWVKEQKSVLLTDTTFR 542
gi 550486     509 LVNGpTTPLATKLKPAEVQPHVPQLPLDLSPEalaaeekgkkvtepPRGFKDILREQGPEGFAKAVRAQKNLLLMDTTFR 588
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        560 DGHQSLLATRMRTYDIARIAGTYSHALPNLLSLECWGGATFDVSMRFLTEDPWERLALIREGAPNLLLQMLLRGANGVGY 639
gi 1709946    566 DAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAY 645
gi 1256798    549 DGHQSLLATRMRTYDIARIAGTYSHALPNLLSLECWGGATFDVSMRFLTEDPWERLALIREGAPNLLLQMLLRGANGVGY 628
gi 489337568  543 DAHQSLLATRIRSHDLKKIANPTAALWPELFSMEMWGGATFDVAYRFLKEDPWKRLEDLRKEVPNTLFQMLLRSSNAVGY 622
gi 550486     589 DAHQSLLATRVRTHDLLKISPYVSHKFNNLYSLENWGGATFDVALRFLHECPWERLEDMRKQIPNIPFQMLLRGANAVGY 668
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        640 TNYPDNVVKYFVRQAAKGGIDLFRVFDCLNWVENMRVSMDAIAEENKLCEAAICYTGDILNSARpKYDLKYYTNLAVELE 719
gi 1709946    646 SSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGK-KYNLDYYLEIAEKIV 724
gi 1256798    629 TNYPDNVVKYFVRQAAKGGIDLFRVFDCLNWVENMRVSMDAIAEENKLCEAAICYTGDILNSARpKYDLKYYTNLAVELE 708
gi 489337568  623 TNYPDNVIKEFVKQSAQSGIDVFRIFDSLNWVKGMTLAIDAVRDTGKVAEAAICYTGDILDKNRtKYDLAYYTSMAKELE 702
gi 550486     669 TNYPDNVVHKFCELSVQCGMDIFRVFDSLNYLPNLILGMEAAGNAGGVVEAAISYTGDVSDPTKkKYDLKYYTNLADELV 748
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        720 KAGAHIIAVXDMAGLLKPAAAKVLFKALREAT-GLPIHFHTHDTSGIAAATVLAAVEAGVDAVDAAMDALSGNTSQPCLG 798
gi 1709946    725 QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYpDLPIHVHTHDSAGTAVASMTACALAGADVVDVAINSMSGLTSQPSIN 804
gi 1256798    709 KAGAHIIAVKDMAGLLKPAAAKVLFKALREAT-GLPIHFHTHDTSGIAAATVLAAVEAGVDAVDAAMDALSGNTSQPCLG 787
gi 489337568  703 AAGAHILGIKDMAGLLKPQAAYELVSALKETI-DIPVHLHTHDTSGNGIYMYAKAVEAGVDIIDVAVSSMAGLTSQPSAS 781
gi 550486     749 KAGTHILCIKDMAGLLKPQAAKLLIAAIREKHpDVPIHIHTHDTSGAGVASMLACAEAGADVVDVAVDSMSGMTSQPSMG 828
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        799 SIVEALSGsERDPGLDPAWIRRISFYWEAVRNQYAAFES--DLKGPASEVYLHEMPGGQFTNLKEQARSLGLETRWHQVA 876
gi 1709946    805 ALLASLEG-NIDTGINVEHVRELDAYWAEMRLLYSCFEA--DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETK 881
gi 1256798    788 SIVEALSGsERDPGLDPAWIRRISFYWEAVRNQYAAFES--DLKGPASEVYLHEMPGGQFTNLKEQARSLGLETRWHQVA 865
gi 489337568  782 GFYHAMEGnDRRPEMNVQGVELLSQYWESVRKYYSEFES--GMKSPHTEIYEHEMPGGQYSNLQQQAKGVGLGDRWNEVK 859
gi 550486     829 AVVASLQGtPLDTGLNLRDISEYSAYWEQTRTLYAPFECttTMKSGNADVYLNEIPGGQYTNLQFQAYSLGLGDFFEDVK 908
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        877 QAYADANQMFGDIVKVTPSSKVVGDMALMMVSQDLTVADVVSPDREVSFPESVVSMLKGDLGQPPSGWPEALQKKALKG- 955
gi 1709946    882 RAYREANYLLGDIVKVTPTSKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNk 961
gi 1256798    866 QAYADANQMFGDIVKVTPSSKVVGDMALMMVSQDLTVADVVSPDREVSFPESVVSMLKGDLGQPPSGWPEALQKKALKG- 944
gi 489337568  860 EMYRRVNDMFGDIVKVTPSSKVVGDMALYMVQNNLTEKDVYEKGESLDFPDSVVELFKGNIGQPHGGFPEKLQKLILKG- 938
gi 550486     909 KAYREANLLLGDIIKVTPSSKVVGDLAQFMVQNHLTADQVMERAEELSFPKSVIEFLQGAIGTPHGGFPEPFRSRVLKD- 987
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A        956 EKPYTVRPGSLLKEADLDAERKVIEKKLeREVSDFEFASYLMYPKVFTDFALASDTYGPVSVLPTPAYFYGLADGEELFA 1035
gi 1709946    962 RRKLTCRPGLELEPFDLEKIREDLQNRF-GDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLPTRSFLSPLETDEEIEV 1040
gi 1256798    945 EKPYTVRPGSLLKEADLDAERKVIEKKLeREVSDFEFASYLMYPKVFTDFALASDTYGPVSVLPTPAYFYGLADGEELFA 1024
gi 489337568  939 QEPITVRPGELLEPVSFEAIKQEFKEQHnLEISDQDAVAYALYPKVFTDYVKTTESYGDISVLDTPTFFYGMTLGEEIEV 1018
gi 550486     988 MPRIEGRPGASLNPLDFDKLKKDLQESH-PDVSDRDVMSAALYPQVTNDYLNFRDSFGPVDKLDTRVFLTGPKVGEEFEV 1066
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QF7_A       1036 DIEKGKTLVIVNQAVS-ATDSQGMVTVFFELNGQPRRIKVPDRAHGATgAAVRRKAEPGNAAHVGAPMPGVISRVFVSSG 1114
gi 1709946   1041 VIEQGKTLIIKLQAVGdLNKKTGEREVYFDLNGEMRKIRVADRSQKVE-TVTKSKADMHDPLHIGAPMAGVIVEVKVHKG 1119
gi 1256798   1025 DIEKGKTLVIVNQAVS-ATDSQGMVTVFFELNGQPRRIKVPDRAHGATgAAVRRKAEPGNAAHVGAPMPGVISRVFVSSG 1103
gi 489337568 1019 EIERGKTLIVKLISIG-EPQPDATRVVYFELNGQPREVVIKDESIKSS-VQERLKADRTNPSHIAASMPGTVIKVLAEAG 1096
gi 550486    1067 TIEKGKTLGFKTLAMAeDLTSNGEREVFFELNGQLRSVMVRDKEAVKE-LHIHPKATKGNKDQVGAPMPGSVIEIKVKVG 1145
                        1130      1140      1150      1160      1170
                  ....*....|....*....|....*....|....*....|....*....|
2QF7_A       1115 QAVNAGDVLVSIEAMKMETAIHAEKDGTIAEVLVKAGDQIDAKDLLAVYG 1164
gi 1709946   1120 SLIKKGQPVAVLSAMKMEMIISSPSDGQVKEVFVSDGENVDSSDLLVLLE 1169
gi 1256798   1104 QAVNAGDVLVSIEAMKMETAIHAEKDGTIAEVLVKAGDQIDAKDLLAVYG 1153
gi 489337568 1097 TKVNKGDHLMINEAMKMETTVQAPFSGTIKQVHVKNGEPIQTGDLLLEIE 1146
gi 550486    1146 DRVEKGQPLVVLSAMKMEMVVQSPRAGVVKSLDISSGMKLEGEDLILTLE 1195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap