2F46


Conserved Protein Domain Family
TIGR01244

?
TIGR01244: TIGR01244 
Click on image for an interactive view with Cn3D
TIGR01244 family protein
No member of this family is characterized. The member from Xylella fastidiosa is a longer protein with an N-terminal region described by this model, followed by a metallo-beta-lactamase family domain and an additional C-terminal region. Members scoring above the trusted cutoff are limited to the proteobacteria. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 130311
View PSSM: TIGR01244
Aligned: 4 rows
Threshold Bit Score: 183.611
Threshold Setting Gi: 2564977
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2F46_A        16 AILKLDEHLYISPQLTKADAEQIAQLGIKTIICNRPDrEEESQPDFAQIKQWLEQAGVTgFHHQPVTARDIQKHDVETFR 95
gi 499289999  15 AILKLDEHLYISPQLTKADAEQIAQLGIKTVICNRPDrEEESQPDFAQIKQWLEQAGVTgFHHQPVTARDIQKHDVETFR 94
gi 499221268   3 DFRFVTESLSVSPQVDPADMARAAAQGFVLVINNRPDgEDPGQPSSASVEAAARAAGMD-YLHVPVR-GGPTPDQVEIMR 80
gi 2564977     2 DLRTLTPDFAVAPQIALDDIAEAARLGFRTLINNRPD-EEVESGLNAALQAAAAAAGLS-YVHLPYYPGELTPDLIAGFE 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
2F46_A        96 QLIGQAEYPVLAYCRTGTRCSLLWGFRRAAEgXPVDEIIRRAQAAGVNLENFRERL 151
gi 499289999  95 QLIGQAESPVLAYCRTGTRCSLLWGFRRAAEgMPVDEIIRRAQAAGVNLENFRERL 150
gi 499221268  81 AAFEAAGGPVLAFCRSGTRSIVTWSIGQALAgVDRETLVAQGYAAGYDLSGVLPA- 135
gi 2564977    80 AALAAADAPVLAWCRSGTRSSHLWALSQAGQ-RPLEEIVQTAQNAGYDLSALVPML 134
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap