Conserved Protein Domain Family
pro_imino_pep_1

?
TIGR01249: pro_imino_pep_1 
proline iminopeptidase, Neisseria-type subfamily
This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.
Statistics
?
PSSM-Id: 130316
View PSSM: TIGR01249
Aligned: 4 rows
Threshold Bit Score: 542.891
Threshold Setting Gi: 1730580
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4406804    19 IEPYSSGNLKVSDVHTLYWEQSGKPDGHPVVFLHGGPGGGTAPSNRRFFDPEFYRIVLFDQRGAGKSTPHACLEENTTWD 98
gi 12230405    5 KQPFHSGYLQVSEIHQIYWEESGNPDGVPVIFLHGGPGAGASPECRGFFNPDVFRIVIIDQRGCGRSRPYACAEDNTTWD 84
gi 1730580     3 TKLNVKGYLNVGDNHQLYYWTQGNPNGKPVLYIHGGPGSGTDEGCLKYFDLETTWIILLDQRGCGKSKTNDIFYENNTDK 82
gi 499196471   8 VTPFEHGILCVDDNHRLYYEQCGNPHGKPVVILHGGPGSGCNDKMRRFHDPDKYRIVLFDQRGAGRSTPHANLTNNTTWD 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4406804    99 LVNDIEKLREHLKIPEWLVFGGSWGSTLALAYSQSHPDKVTGLVLRGIFLLRKKEIDWFYEGG-AAAIYPDAWEEFRDLI 177
gi 12230405   85 LVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETVWLNEAGgVSRIYPEQWQKFVAPI 164
gi 1730580    83 LVSDFEILRQKLNIKNWTLFGGSWGSALALVYAIKHPQVVDKIFLRALFLAREKDWSEALMGl-GKMFYPYEHQRFMDSI 161
gi 499196471  88 LVADIEKLRVALGITRWQVFGGSWGSTLALAYAQTHPEQTTELVLRGIFMLRRWELEWFYQEG-ASHLFPDAWDRYIAVI 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4406804   178 PENERg--SSLVDAYHKRLNSDDLEIQYAAARAWTKWEmmTAYLRPNLENVQkaEDDKFSLAFARIENHYFVNKGFFPSD 255
gi 12230405  165 AENRR---NRLIEAYHGLLFHQDEEVCLSAAKAWADWE--SYLIRFEPEEVD--EDAYASLAIARLENHYFVNGGWLQGD 237
gi 1730580   162 PKAYQnsyEQIVNYCYDQFQNGDESTKEKLAKAWVDWEs--TLLSPINKIHStaTDFKLVEKLALLECHYAVNKSFLD-E 238
gi 499196471 167 PPVER---HDLISAFHRRLTSEDEATRLAAAQAWSLWEgaTSCLYMDQDFIAshENPHFALAFARIENHYFVNGGFFEVE 243
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4406804   256 SHLLDNVDKIRHIKTTIVQGRYDVCCPMMSAWDLHKAWPEAELKIVYdAGHSANEPGISAELVVANEKMK 325
gi 12230405  238 RAILNNIGKIRHIPTIIVQGRYDLCTPMQSAWALSKAFPEAELRVVQ-AGHRAFDPPLVDALVQAVEDIL 306
gi 1730580   239 NFILDNISVLKNKSIYLAHGRFDLICPLYQPLALKQAFPELQLYVTNnAGHSGSDANNLATIKHLLKTYL 308
gi 499196471 244 NQLLRDAQRIANIPGVIVHGRYDVVCPLQNAWDLHKVWPKASLKITPgAGHSAFEPQNIDALVCATDSFV 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap