Conserved Protein Domain Family
Tyr_3_monoox

?
TIGR01269: Tyr_3_monoox 
tyrosine 3-monooxygenase, tetrameric
This model describes tyrosine 3-monooxygenase, a member of the family of tetrameric, biopterin-dependent aromatic amino acid hydroxylases found in metazoans. It is closely related to tetrameric phenylalanine-4-hydroxylase and tryptophan 5-monooxygenase, and more distantly related to the monomeric phenylalanine-4-hydroxylase found in some Gram-negative bacteria.
Statistics
?
PSSM-Id: 130336
View PSSM: TIGR01269
Aligned: 3 rows
Threshold Bit Score: 793.366
Threshold Setting Gi: 3183187
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 595801   48 KQTVLEEARSKANdYGLTEDEILLANAASESSDAEAAMQSAALVVRLKEgISSLGRILKAIETFHGTVQHVESRQSRVEG 127
gi 3183188  36 RQSLIEDARKERE-AAAAAESSEASEQIVFDEEDGKALLNLFFTLRSSK-IPALSRALKVFETFEAKIHHLETRTRRKPK 113
gi 3183187  16 KSSTVELNHNEKD--GRIHSIIINFHPITHEQ-S-----NNQFYIQT------LHEILKYIIDKKLNLVHFETRPTLTLS 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 595801  128 -----VDHDVLIKLDMTRGNLLQLIRSLRQsgsfSSMNLMADNnlNVKAPWFPKHASELDNCNHLMTKYEPDLDMNHPGF 202
gi 3183188 114 ds--lEDLEYFVRCEVHLADVSTLISSIRR----IAEDVRTTK--EVKFHWFPKKISELDSCHHLVTKFDPDLDQDHPGF 185
gi 3183187  82 nanrdVQYSCLITLEANEINMSLLYEELRGnsfiSGINLLNNQ---ESEDWYPKHISDLDKCQHLLRKFQPELQTDHPGF 158
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 595801  203 ADKVYRQRRKEIAEIAFAYKYGDPIPFIDYSDVEVKTWRSVFKTVQDLAPKHACAEYRAAFQKLQDEQIFVETRLPQLQE 282
gi 3183188 186 TDPVYRQRRRMIGEIAFRYKHGEPIPRVEYTEEEIGTWREVYSTLRDLYTTHACSEHLEAFRLLERHCGYSPNSIPQLED 265
gi 3183187 159 HDKVYRERREAIAKIAFQYKYGDRIPEVEYTKEEIETWGLVFTKMKAVHASRACREYIDGFQLLEKYCNYNSESIPQLQT 238
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 595801  283 MSDFLRKNTGFSLRPAAGLLTARDFLASLAFRIFQSTQYVRHVNSPYHTPEPDSIHELLGHMPLLADPSFAQFSQEIGLA 362
gi 3183188 266 VSHFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCVHELLGHVPMLADRTFAQFSQNIGLA 345
gi 3183187 239 ICEFMHRTSGFRIRPVAGLVSPKDFLASLAFRVFQCTQYIRHHSRPMHTPEPDCIHELIGHMPMLVNRQFADFSQELGLA 318
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 595801  363 SLGASDEEIEKLSTVYWFTVEFGLCKEHGQIKAYGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVA 442
gi 3183188 346 SLGASEEDIEKLSTLYWFTVEFGLCKQGDGVKAYGAGLLSSYGELVHSLSDEPERREFDPEAAAAEPYQDQNYQSVYFVS 425
gi 3183187 319 SLGASEEEITRLSTLYWFTVEFGLCNENGETRALGAGIMSSYGELENAFSDLSVKEPFNINDAAVQVYDDVGYQKIYFVT 398
                      410       420       430       440       450       460
               ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 595801  443 ESFEDAKDKFRRWVSTMSRPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKLR 505
gi 3183188 426 ESFTDAKEKLRVYAAGINRPFSVRFDPYTYSIEVLDNPLKIRGGLESVKDELKVLTDALNVLA 488
gi 3183187 399 ESIESMKRELRNYINTSGKSTIPIYDPITETVHMKSRFSIRKELLKHVKEEIGQLDTLLNHSN 461
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap