1F2D


Conserved Protein Domain Family
ACC_deam

?
TIGR01274: ACC_deam 
Click on image for an interactive view with Cn3D
1-aminocyclopropane-1-carboxylate deaminase
This pyridoxal phosphate-dependent enzyme degrades 1-aminocyclopropane-1-carboxylate, which in plants is a precursor of the ripening hormone ethylene, to ammonia and alpha-ketoglutarate. This model includes all members of this family for which function has been demonstrated experimentally, but excludes a closely related family often annotated as putative members of this family. [Central intermediary metabolism, Other]
Statistics
?
PSSM-Id: 130341
View PSSM: TIGR01274
Aligned: 4 rows
Threshold Bit Score: 592.197
Threshold Setting Gi: 7024439
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1F2D_A       2 GVAKFAKYPLTFGPSPISNLNRLSQHLGSK-----VNVYAKREDCNSGLAFGGNKLRKLEYIVPDIVEGDYTHLVSIGGR 76
gi 231361    2 NLQRFPRYPLTFGPTPIQPLARLSKHLGGK-----VHLYAKREDCNSGLAFGGNKTRKLEYLIPEALAQGCDTLVSIGGI 76
gi 8469097   2 NLNRFERYPLTFGPSPITPLKRLSQHLGGK-----VELYAKREDCNSGLAFGGNKTRKLEYLIPEAIEQGCDTLVSIGGI 76
gi 7024439  12 PFSTIPRTPLLLGPSPIHPLPRTTADLAKNnphplVTIYAKRDDLNSGYAYGGNKTRKLEYLLADAQAQGCTTLVSIGGV 91
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1F2D_A      77 QSNQTRMVAALAAKLGKKCVLIQEDWVPIPEAekdVYNRVGNIELSRIMGADVRVIEDGFDIGMRKSFANALQELEDAGH 156
gi 231361   77 QSNQTRQVAAVAAHLGMKCVLVQENWVNYSDA---VYDRVGNIQMSRILGADVRLVPDGFDIGFRRSWEDALESVRAAGG 153
gi 8469097  77 QSNQTRQVAAVAAHLGMKCVLVQENWVNYSDA---VYDRVGNIEMSRIMGADVRLDAAGFDIGIRPSWEKAMSDVVEQGG 153
gi 7024439  92 QSNHTRQVAAVAARSGLKARLVQEHWVDWTDP---GYESTGNIQLSRLMGADVRLDPSGFGIEHKNTVQRVVEEARGDGE 168
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1F2D_A     157 KPYPIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVTGSTTAGILAGMAQYGR------QDDVIAIDASFT 230
gi 231361  154 KPYAIPAGCSDHPLGGLGFVGFAEEVRAQEAELGFKFDYVVVCSVTGSTQAGMVVGFAADGR------ADRVIGVDASAK 227
gi 8469097 154 KPFPIPAGCSEHPYGGLGFVGFAKKLRQQEKELGFKFNYIVVCSVTGSTQAGMVVGFAADGR------SKNVIGVDASAK 227
gi 7024439 169 KPYYIPAGASDHPLGGLGFARWAFEVREQEGEMGVFFDTVLVCAVTGSTFAGMIAGFKLLERlypadaKRRVVGIDASAT 248
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1F2D_A     231 SEKTKEQTLRIANNTAKLIGVEH-EFK--DFTLDTRFAYPCYGVPNEGTIEAIRTCAEQEGVLTDPVYEGKSMQGLIALI 307
gi 231361  228 PAQTREQITRIARQTAEKVGLER-DIMraDVVLDERFAGPEYGLPNEGTLEAIRLCARTEGMLTDPVYEGKSMHGMIEMV 306
gi 8469097 228 PEQTKAQILRIARHTAELVELGR-EITeeDVVLDTRFAYPEYGLPNEGTLEAIRLCGSLEGVLTDPVYEGKSMHGMIEMV 306
gi 7024439 249 VEATRAQVLRIAKNTAAKIGLSEdDITedDVMLDDRYHAGIYGVPDRQTWDAIEYAAKMEAFITDPVYEGKSFAGMMDMI 328
                      330       340       350
               ....*....|....*....|....*....|..
1F2D_A     308 KEDYFKPGANVLYVHLGGAPALSAYSSFFPTK 339
gi 231361  307 RNGEFPEGSRVLYAHLGGVPALNGYSFIFRDG 338
gi 8469097 307 RRGEFPEGSKVLYAHLGGAPALNAYSFLFRDG 338
gi 7024439 329 RRGEIK-GGNILYAHLGGQLALNAYSELGRTN 359
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap